DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and cyn-13

DIOPT Version :10

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001255925.1 Gene:cyn-13 / 178487 WormBaseID:WBGene00000889 Length:331 Species:Caenorhabditis elegans


Alignment Length:147 Identity:69/147 - (46%)
Similarity:91/147 - (61%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MGEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIRDFMIQGGDPT-GTGRGGASIYGS 89
            :|.|.:||.....|.|..||..|  ..||: |...:|||||..||:||||.| |.|.||.||||:
 Worm   152 IGRIVIELRTDVTPKTAENFRCLCTGERGFGYEGSIFHRIIPKFMLQGGDFTKGDGTGGKSIYGT 216

  Fly    90 EFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMV 154
            :|.|| :..||||..|.:||||.|.:||||||||....|.||||||.:||.|..||.:|:::...
 Worm   217 KFDDE-NFTLRHTMPGTVSMANCGANTNGSQFFICTEKTDWLDGKHVVFGHVVEGMNIVRQVEQQ 280

  Fly   155 ETDKNDRPVDPLRIIKA 171
            .| .:.:|...::|:::
 Worm   281 GT-PSGKPQMVVKIVES 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:469651 69/144 (48%)
cyn-13NP_001255925.1 RRM_PPIE 13..87 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 69/147 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.