DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and cyn-2

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_499828.1 Gene:cyn-2 / 176807 WormBaseID:WBGene00000878 Length:172 Species:Caenorhabditis elegans


Alignment Length:133 Identity:66/133 - (49%)
Similarity:82/133 - (61%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GEITVELYWKHAPNTCRNFAEL----------SRRGYYNNVVFHRIIRDFMIQGGDPT-GTGRGG 83
            |.|.:|||....|.|..||..|          .::.::....|||||.:|||||||.| |.|.||
 Worm    18 GRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGG 82

  Fly    84 ASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVV 148
            .||:|.:|.||...: :|||.|:|||||.|.:|||||||:....|.||||||.:||:|..||:||
 Worm    83 ESIHGEKFDDENFKE-KHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVV 146

  Fly   149 KRI 151
            |.|
 Worm   147 KAI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 66/133 (50%)
cyn-2NP_499828.1 cyclophilin_ABH_like 5..169 CDD:238907 66/133 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.