DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and cyn-15

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_493378.1 Gene:cyn-15 / 173225 WormBaseID:WBGene00000891 Length:629 Species:Caenorhabditis elegans


Alignment Length:152 Identity:77/152 - (50%)
Similarity:103/152 - (67%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYGS 89
            :.||.|:||:.|:....|.|..||...|||||||.:.|||:|:.||||.|||:|.|.||.||:|.
 Worm   478 IHTSFGDITIRLFGDECPKTVENFCTHSRRGYYNGLTFHRVIKSFMIQTGDPSGKGTGGESIWGE 542

  Fly    90 EFADELHGDLRHTGAGILSMANS-GPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGM 153
            :|.||.|..|||.....:||||: |.:|||||||||:.|..|||||:|:||.|..||.||:||..
 Worm   543 DFEDEFHPRLRHDKPFKVSMANAGGGNTNGSQFFITVCPADWLDGKNTLFGEVTAGMSVVQRINQ 607

  Fly   154 VET-DKNDRPVDPLRIIKAKVE 174
            |.| :::.||.:.::|:...::
 Worm   608 VSTFERSGRPRESIQIMSISLK 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 77/146 (53%)
cyn-15NP_493378.1 WD40 53..>285 CDD:392136
WD40 repeat 101..142 CDD:293791
WD40 repeat 150..185 CDD:293791
WD40 repeat 192..237 CDD:293791
cyclophilin 477..626 CDD:381853 77/147 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.