DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and Ppif

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_598845.1 Gene:Ppif / 105675 MGIID:2145814 Length:206 Species:Mus musculus


Alignment Length:153 Identity:71/153 - (46%)
Similarity:88/153 - (57%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NNAGGIPDKAWQPHFVTLETS-----MGEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHR 64
            |::.|.|       .|.|:..     :|.:.:||.....|.|..||..|  ..:|: |....|||
Mouse    39 NSSSGNP-------LVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHR 96

  Fly    65 IIRDFMIQGGDPTG-TGRGGASIYGSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPT 128
            :|..||.|.||.|. .|.||.|||||.|.|| :..|:|.|.|:|||||:||:||||||||....|
Mouse    97 VIPAFMCQAGDFTNHNGTGGRSIYGSRFPDE-NFTLKHVGPGVLSMANAGPNTNGSQFFICTIKT 160

  Fly   129 QWLDGKHTIFGRVYTGMEVVKRI 151
            .||||||.:||.|..||:|||:|
Mouse   161 DWLDGKHVVFGHVKEGMDVVKKI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 67/137 (49%)
PpifNP_598845.1 cyclophilin_ABH_like 45..203 CDD:238907 69/147 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.