DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and PPIE

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens


Alignment Length:133 Identity:66/133 - (49%)
Similarity:83/133 - (62%) Gaps:5/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GEITVELYWKHAPNTCRNFAEL--SRRGY-YNNVVFHRIIRDFMIQGGDPTG-TGRGGASIYGSE 90
            |.|.:.|.....|.|..||..|  ..:|: :....|||||..||.||||.|. .|.||.||||.:
Human   154 GRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKK 218

  Fly    91 FADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMVE 155
            |.|| :..|:|||.|:||||||||:|||||||:|...|.||||||.:||.|..|::|:::|.:..
Human   219 FDDE-NFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEVAP 282

  Fly   156 TDK 158
            ..|
Human   283 DTK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 66/133 (50%)
PPIENP_001181936.1 RRM <5..>84 CDD:223796
RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 140..279 CDD:238907 64/125 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.