DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cypl and ppwd1

DIOPT Version :9

Sequence 1:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_002934239.3 Gene:ppwd1 / 100488042 XenbaseID:XB-GENE-1001509 Length:640 Species:Xenopus tropicalis


Alignment Length:151 Identity:85/151 - (56%)
Similarity:104/151 - (68%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIYGS 89
            :.||||:|.|:|:....|.|..||...||.||||..:|||:|:.||||.|||||||.||.||:|.
 Frog   490 IHTSMGDIHVKLFPVECPKTVENFCVHSRNGYYNRHMFHRVIKGFMIQTGDPTGTGMGGESIWGG 554

  Fly    90 EFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRIGMV 154
            ||.||.|..|||.....|||||:||.|||||||:|:.||.|||.|||:||||..|||||:||...
 Frog   555 EFEDEFHATLRHDRPYTLSMANAGPSTNGSQFFLTVVPTPWLDNKHTVFGRVTKGMEVVQRICNS 619

  Fly   155 ETD-KNDRPVDPLRIIKAKVE 174
            :.: |.|:|.:.:.||...|:
 Frog   620 KVNPKTDKPYEDISIINITVK 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 83/145 (57%)
ppwd1XP_002934239.3 WD40 83..312 CDD:421866
WD40 repeat 88..125 CDD:293791
WD40 repeat 131..169 CDD:293791
WD40 repeat 177..213 CDD:293791
WD40 repeat 221..266 CDD:293791
cyclophilin_WD40 489..637 CDD:238908 84/146 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.