DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS6 and Borcs6

DIOPT Version :9

Sequence 1:NP_001261214.1 Gene:BORCS6 / 38068 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_082281.2 Gene:Borcs6 / 71923 MGIID:1919173 Length:360 Species:Mus musculus


Alignment Length:337 Identity:82/337 - (24%)
Similarity:148/337 - (43%) Gaps:69/337 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHRHQDIPIRPRYGYVAE-------ESGPSEGAARSSGSG--ATPASSYTEIPFLAQYPGAVPE 56
            :|.||.....:...|.:|.       |..||..|..|...|  ..|.|.:...| .:.||  .||
Mouse    53 VSSRHPRASPKTWSGSIAHGPELDTWEDKPSSRATPSGARGRRGVPGSEHAPPP-SSWYP--EPE 114

  Fly    57 HVLQDLTPTATGHAAIPGSTKTRPNGEKYLNLD----SGEDPDEEDD-----------PLEEEDN 106
                   |:....:|:....:..|.|.: :|::    .|:|.|:||:           |...:|:
Mouse   115 -------PSEDQPSALRVCRRGSPGGVE-MNVELPQQEGDDDDDEDEEAAAGRAGRSFPSRLQDS 171

  Fly   107 -------------SNSNSNSKGSSGDIERHRLKAESTVPYELDGETSDSDGMRHFVAHDLEAKLR 158
                         .:|:|...|:.|.     .:|..:.|.||:|..|....:.||||::|:.|:|
Mouse   172 RSLDGLSGACGGGGSSSSGETGAGGG-----RRATISSPLELEGTVSRHGDLTHFVANNLQLKIR 231

  Fly   159 ERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDN 223
            ...|..........|..:..|                :..||.:|..||.|:|..::.|...||.
Mouse   232 LSGAPPPVPPASVRPCLTPAP----------------TPTIPPIDPDVLRDLERLSRELGGRVDR 280

  Fly   224 LMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRI 288
            |:..||..:..:::::...::.:|:||:.|.:.:|.:||..|.|||:.||:.::::|.:.|.:::
Mouse   281 LLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQV 345

  Fly   289 RQIKRLVDMLDS 300
            |.|:|.:::|::
Mouse   346 RDIRRTLEVLEA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS6NP_001261214.1 DUF2365 142..301 CDD:287166 42/159 (26%)
Borcs6NP_082281.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..201 34/163 (21%)
DUF2365 215..358 CDD:287166 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848846
Domainoid 1 1.000 79 1.000 Domainoid score I8727
eggNOG 1 0.900 - - E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5101
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006641
OrthoInspector 1 1.000 - - oto93978
orthoMCL 1 0.900 - - OOG6_106297
Panther 1 1.100 - - LDO PTHR13440
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4339
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.