DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS6 and borcs6

DIOPT Version :9

Sequence 1:NP_001261214.1 Gene:BORCS6 / 38068 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001038453.1 Gene:borcs6 / 562545 ZFINID:ZDB-GENE-060531-151 Length:435 Species:Danio rerio


Alignment Length:296 Identity:77/296 - (26%)
Similarity:134/296 - (45%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PRYGYVAEESGPSEGAARSSGSGATPASSYTEIPFLAQYP---GAVPEHVLQDLTPT-ATGHAAI 72
            |.:..:.|.|.|:........:..:|    .|.|.|...|   .|.|..:|.||..: ...|...
Zfish   161 PTHSEIEEWSNPNSVDEFQPNTSISP----DEAPPLVPAPPPDQATPPPLLPDLDDSPCPAHVMA 221

  Fly    73 PGSTKTRPNGEKYLNLDSGEDPDEEDDPLEEEDNSNSNSNSKGS---SGDIERHRLKAESTVPYE 134
            ....::.|..|:.:.       ..:|....:|.:......::|.   .|..|..|....|.:  |
Zfish   222 EVRVRSVPERERVVR-------GMQDSKSLDEISGACGGGTRGGGARGGQAEGRRATISSAL--E 277

  Fly   135 LDGETSDSDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATSGNGLLTRRFLQSRNI 199
            |:|..|....:.||:..:||.|::.....|.     .|.....|||  |.|.|.|.|    ..:|
Zfish   278 LEGTVSHDGDLTHFITKNLEQKIKMSSRPSL-----DTDSDCSGPI--TRGRGSLRR----PADI 331

  Fly   200 PEVDGSVLSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNAVNKLTDTLDANIKCQ 264
            |.:|.|||.|:....|.:|.||:.::.:|...:.::::::...::.:|::|:.|.:::|.:||..
Zfish   332 PPIDPSVLVDLHKHTQDVAQSVELMLRSLNGTIQNMTALSVGYIQTYRDSVDSLGESVDMSIKGM 396

  Fly   265 YQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            |.|:|:.||:.:||:|...|..:||.|||.:|.|::
Zfish   397 YTLMARCEELDRSMQPIHTLAAQIRDIKRTLDALET 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS6NP_001261214.1 DUF2365 142..301 CDD:287166 49/159 (31%)
borcs6NP_001038453.1 DUF2365 285..433 CDD:287166 49/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594378
Domainoid 1 1.000 83 1.000 Domainoid score I8267
eggNOG 1 0.900 - - E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5087
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006641
OrthoInspector 1 1.000 - - oto39859
orthoMCL 1 0.900 - - OOG6_106297
Panther 1 1.100 - - LDO PTHR13440
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4339
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.