DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS6 and BORCS6

DIOPT Version :9

Sequence 1:NP_001261214.1 Gene:BORCS6 / 38068 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_060092.2 Gene:BORCS6 / 54785 HGNCID:25939 Length:357 Species:Homo sapiens


Alignment Length:328 Identity:82/328 - (25%)
Similarity:141/328 - (42%) Gaps:83/328 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RPRYGYVAEESGPSEGAARSSGS--GATPASSYTEIPFLAQYPGAVPEHVLQDLTPTATGHAAIP 73
            ||....:..|.|| :|....:||  ||               |||  ||     .|:.:.....|
Human    72 RPEREALENEPGP-QGTLSGAGSRRGA---------------PGA--EH-----EPSLSSRHKNP 113

  Fly    74 GSTKTRPNGEKYLNLDSGED-------------PDEEDDPLEE---------------EDNSNSN 110
            ...:.:|:        ||.|             ..||:|..||               :|:.:.:
Human   114 APPEGKPS--------SGRDCRRGGPGGGMDVEQQEEEDNDEEAAAGSRAGRSFSSRLQDSRSLD 170

  Fly   111 SNSK-----GSSGDIERHR---LKAESTVPYELDGETSDSDGMRHFVAHDLEAKLRERVAASAYS 167
            ..|:     ||||..|...   .:|..:.|.||:|..|....:.||||::|:.|:|...|.....
Human   171 GLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPPPPP 235

  Fly   168 SEHTTPLSSMGPIGATSGNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDNLMENLGNLL 232
            |....|..:..|....:              ||.:|..||.|:|..::.|...||.|:..||..:
Human   236 SAPARPCPAPAPTPTPA--------------IPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAV 286

  Fly   233 HSISSITADNVEVHRNAVNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDM 297
            ..:::::...::.:|:||:.|.:.:|.:||..|.|||:.||:.::::|.:.|.:::|.|:|.:::
Human   287 QELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEV 351

  Fly   298 LDS 300
            |::
Human   352 LEA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS6NP_001261214.1 DUF2365 142..301 CDD:287166 43/159 (27%)
BORCS6NP_060092.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..196 35/161 (22%)
DUF2365 210..355 CDD:287166 39/144 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..256 3/28 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158451
Domainoid 1 1.000 81 1.000 Domainoid score I8575
eggNOG 1 0.900 - - E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5113
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006641
OrthoInspector 1 1.000 - - oto90394
orthoMCL 1 0.900 - - OOG6_106297
Panther 1 1.100 - - LDO PTHR13440
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4339
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.