DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS6 and Borcs6

DIOPT Version :9

Sequence 1:NP_001261214.1 Gene:BORCS6 / 38068 FlyBaseID:FBgn0035140 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001017474.2 Gene:Borcs6 / 497934 RGDID:1563885 Length:360 Species:Rattus norvegicus


Alignment Length:311 Identity:83/311 - (26%)
Similarity:145/311 - (46%) Gaps:62/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ESGPSEGAARSS--GSGATPASSYTEIPFLAQYPGAVPEHVLQDLTPTATGHAAIPGSTKTRPNG 82
            |..||..|..|.  ||..|..|.:|..| .:.||  .||       |:....:|:....:..|.|
  Rat    79 EDKPSARATPSGARGSRGTSGSEHTPPP-SSWYP--EPE-------PSEDQPSALTVCRRGSPGG 133

  Fly    83 EKYLNLD----SGEDPDEEDD-----------PLEEEDN-------------SNSNSNSKGSSGD 119
            .: :|::    .|:|.|:.||           |...:|:             .:|:|...|:.|.
  Rat   134 VE-MNVELPQQEGDDDDDGDDEEAADRAGHSFPSRLQDSRSLDGLSGACGGGGSSSSGEAGAGGG 197

  Fly   120 IERHRLKAESTVPYELDGETSDSDGMRHFVAHDLEAKLRERVAASAYSSEHTTPLSSMGPIGATS 184
                 .:|..:.|.||:|..|....:.||||::|:.|:|...|.|              |:...|
  Rat   198 -----RRATISSPLELEGTVSRHGDLTHFVANNLQLKIRLSGAPS--------------PVPPAS 243

  Fly   185 GNGLLTRRFLQSRNIPEVDGSVLSDIELEAQYLASSVDNLMENLGNLLHSISSITADNVEVHRNA 249
            |...||.  ..:..||.:|..||.|:|..::.|...||.|:..||..:..:::::...::.:|:|
  Rat   244 GRPCLTP--APTPTIPPIDPDVLRDLERLSRELGGRVDRLLCGLGGAVQELTALSVGCIQTYRDA 306

  Fly   250 VNKLTDTLDANIKCQYQLLAKAEEITKSMKPTEQLGQRIRQIKRLVDMLDS 300
            |:.|.:.:|.:||..|.|||:.||:.::::|.:.|.:::|.|:|.:::|::
  Rat   307 VDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLEVLEA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS6NP_001261214.1 DUF2365 142..301 CDD:287166 46/159 (29%)
Borcs6NP_001017474.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..201 31/137 (23%)
DUF2365 215..358 CDD:287166 46/159 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352451
Domainoid 1 1.000 82 1.000 Domainoid score I8259
eggNOG 1 0.900 - - E1_KOG4514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4980
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006641
OrthoInspector 1 1.000 - - oto97508
orthoMCL 1 0.900 - - OOG6_106297
Panther 1 1.100 - - LDO PTHR13440
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.