DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and Zbtb46

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_081932.1 Gene:Zbtb46 / 72147 MGIID:1919397 Length:600 Species:Mus musculus


Alignment Length:439 Identity:95/439 - (21%)
Similarity:140/439 - (31%) Gaps:163/439 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 QQPMEVTSQLKGPTETLGEFQPSISESWPSEDGYDLPEDLECWPWMEDAVPE--AGLVLPTPSEV 649
            |:|     :..||.:.      |....||.:.||......|     |...|.  .|..||:..:.
Mouse   201 QEP-----KADGPDDV------SSQSLWPGDVGYGSLRIKE-----EQISPSHYGGSELPSSKDT 249

  Fly   650 ANAPPLD-----------GLSHNAVDLLVKDFSHLYAAPPEDTQNAEEGTAAGGRGTVPPLVPVT 703
            |....|.           |...|..:  .:...|:       ||..||.:.||  ..||..:| |
Mouse   250 AIQNSLSEQGSGDGWQPTGRRKNRKN--KETVRHI-------TQQVEEDSQAG--SPVPSFLP-T 302

  Fly   704 SSEGTASVAQSAALGSLPVPPLVPLAAEMNAAIEKPARIYVANNLLPAAVDPPLLGGGTSVRGRP 768
            |....:|...:..|       .|..|:.:::..|: |.:|       |.:|..||||.||..|.|
Mouse   303 SGWPFSSRDSNVDL-------TVTEASSLDSRGER-AELY-------AHIDEGLLGGETSYLGPP 352

  Fly   769 Y-----GAKHSGGAASKRK---------LSLGPNQVPEGGKCLVEGCMFRFKSPVTLEYHGR-CH 818
            .     .|.|...|.:..:         |||..:.:.:.|..|             .||..: .|
Mouse   353 LTPEKEEALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLL-------------FEYLPKGAH 404

  Fly   819 NGSLSSNQPVVCPECKSSNFSNWNCLHTHLWRTHQIDMELYSCQLCSFKTPIYSRLVNTHAKIHS 883
              |||.|:..|.                         .:.:.|..||| :.::..::..|.:.|:
Mouse   405 --SLSLNEFTVI-------------------------RKKFKCPYCSF-SAMHQCILKRHMRSHT 441

  Fly   884 EERNYKCEQCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNEQISVGPEGNPVVMHRCEDCGAAFKQ 948
            .||.|.||.|||.|...:.:|.|..:|.                                   |.
Mouse   442 GERPYPCEICGKKFTRREHMKRHTLVHS-----------------------------------KD 471

  Fly   949 KKTLREHLCKERNEQLECPECQRRFGSKSSLRLHLRSHQEHKRFRCDTC 997
            ||    ::||         .|.|.|.|.:|:.:   .|...:...|..|
Mouse   472 KK----YVCK---------VCSRVFMSAASVGI---KHGSRRHGVCADC 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 0/21 (0%)
C2H2 Zn finger 861..882 CDD:275368 5/20 (25%)
zf-H2C2_2 875..899 CDD:290200 11/23 (48%)
zf-C2H2 888..910 CDD:278523 9/21 (43%)
C2H2 Zn finger 890..910 CDD:275368 8/19 (42%)
zf-C2H2_2 893..999 CDD:289522 20/105 (19%)
C2H2 Zn finger 939..956 CDD:275368 3/16 (19%)
RPB9 966..1061 CDD:224510 8/32 (25%)
C2H2 Zn finger 966..986 CDD:275368 5/19 (26%)
C2H2 Zn finger 994..1014 CDD:275368 2/4 (50%)
C2H2 Zn finger 1022..1042 CDD:275368
C2H2 Zn finger 1055..1075 CDD:275368
Zbtb46NP_081932.1 BTB_POZ_ZBTB46 10..134 CDD:349539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..222 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..278 8/44 (18%)
zf-H2C2_5 418..442 CDD:372805 6/24 (25%)
C2H2 Zn finger 420..440 CDD:275368 5/20 (25%)
zf-H2C2_2 433..457 CDD:372612 11/23 (48%)
C2H2 Zn finger 448..468 CDD:275368 8/19 (42%)
zf-H2C2_2 460..483 CDD:372612 10/70 (14%)
C2H2 Zn finger 476..498 CDD:275368 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.