DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and Zfp787

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001013030.1 Gene:Zfp787 / 67109 MGIID:1914359 Length:381 Species:Mus musculus


Alignment Length:165 Identity:55/165 - (33%)
Similarity:76/165 - (46%) Gaps:30/165 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   827 PVVCPECKSSNFSNWNCLHTHLWRTHQIDMELYSCQLCSFKTPIYSRLVNTHAKIHSEERNYKCE 891
            |.:|.||..| ||:|:.|..| .|||..:.. .:|..|. ||...|..:..|.:||:.|:.|.|.
Mouse    65 PYICTECGKS-FSHWSKLTRH-QRTHTGERP-NACTDCG-KTFSQSSHLVQHRRIHTGEKPYACS 125

  Fly   892 QCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNEQISVGPEGNPVVMHRCEDCGAAFKQKKTLREHL 956
            :|||.|..:..|..|:|:|..:                  .|   :.|.|||.:|.|.|:|.:| 
Mouse   126 ECGKRFSWSSNLMQHQRIHTGE------------------KP---YTCPDCGRSFTQSKSLAKH- 168

  Fly   957 CKERNEQLE---CPECQRRFGSKSSLRLHLRSHQE 988
             :..:..|:   ||.|.|.|....||..|||.|.|
Mouse   169 -RRSHSGLKPFVCPRCGRGFSQPKSLARHLRLHPE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 10/21 (48%)
C2H2 Zn finger 861..882 CDD:275368 6/20 (30%)
zf-H2C2_2 875..899 CDD:290200 10/23 (43%)
zf-C2H2 888..910 CDD:278523 9/21 (43%)
C2H2 Zn finger 890..910 CDD:275368 8/19 (42%)
zf-C2H2_2 893..999 CDD:289522 31/99 (31%)
C2H2 Zn finger 939..956 CDD:275368 8/16 (50%)
RPB9 966..1061 CDD:224510 12/23 (52%)
C2H2 Zn finger 966..986 CDD:275368 10/19 (53%)
C2H2 Zn finger 994..1014 CDD:275368
C2H2 Zn finger 1022..1042 CDD:275368
C2H2 Zn finger 1055..1075 CDD:275368
Zfp787NP_001013030.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65 55/165 (33%)
zf-C2H2 66..88 CDD:395048 10/23 (43%)
C2H2 Zn finger 68..88 CDD:275368 10/21 (48%)
COG5048 <93..200 CDD:227381 40/131 (31%)
C2H2 Zn finger 96..116 CDD:275368 6/20 (30%)
C2H2 Zn finger 124..144 CDD:275368 8/19 (42%)
C2H2 Zn finger 152..172 CDD:275368 9/21 (43%)
C2H2 Zn finger 180..200 CDD:275368 10/19 (53%)
C2H2 Zn finger 282..302 CDD:275368
C2H2 Zn finger 319..339 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.