DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and Plagl2

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_061277.2 Gene:Plagl2 / 54711 MGIID:1933165 Length:496 Species:Mus musculus


Alignment Length:239 Identity:65/239 - (27%)
Similarity:92/239 - (38%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   828 VVCPECKSSN--FSNWNCLHTHLWRTHQI---DMELYSC-QLCSFKTPIYSRLVNTHAKIHSEER 886
            |.| :|:.|.  |||...|     |.|.:   :...||| ||...|.......:..|...||.::
Mouse    38 VKC-QCEISGTPFSNGEKL-----RPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQK 96

  Fly   887 NYKCEQCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNEQISVGPEGNPVVMHRCEDCGAAFKQKKT 951
            .::|..|.|.|.....|:||.:.|                   :.|...:| |.:||..:..|..
Mouse    97 PHQCMYCDKMFHRKDHLRNHLQTH-------------------DPNKEALH-CSECGKNYNTKLG 141

  Fly   952 LREHLCKE--RNEQLECPECQRRFGSKSSLRLHLRSHQ-------EHKRFRCDTCDHETSDHNAY 1007
            .|.||...  .:..|.|..|.:.|.|..:|..||::|.       :.|:..||.||.........
Mouse   142 YRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDV 206

  Fly  1008 RRHLATHKESKRYSCPHCDFRAIQSTAFRIHLQTRHPEQELSTI 1051
            ||||..|...|.:.|.:|..|..:......|::..| .|||..|
Mouse   207 RRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSH-SQELLKI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 8/23 (35%)
C2H2 Zn finger 861..882 CDD:275368 5/21 (24%)
zf-H2C2_2 875..899 CDD:290200 7/23 (30%)
zf-C2H2 888..910 CDD:278523 7/21 (33%)
C2H2 Zn finger 890..910 CDD:275368 7/19 (37%)
zf-C2H2_2 893..999 CDD:289522 29/114 (25%)
C2H2 Zn finger 939..956 CDD:275368 5/16 (31%)
RPB9 966..1061 CDD:224510 28/93 (30%)
C2H2 Zn finger 966..986 CDD:275368 7/19 (37%)
C2H2 Zn finger 994..1014 CDD:275368 8/19 (42%)
C2H2 Zn finger 1022..1042 CDD:275368 4/19 (21%)
C2H2 Zn finger 1055..1075 CDD:275368
Plagl2NP_061277.2 C2H2 Zn finger 42..62 CDD:275368 8/24 (33%)
C2H2 Zn finger 70..92 CDD:275368 5/21 (24%)
zf-H2C2_2 85..109 CDD:372612 7/23 (30%)
C2H2 Zn finger 100..120 CDD:275368 7/19 (37%)
C2H2 Zn finger 129..149 CDD:275368 7/19 (37%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 193..213 CDD:275368 8/19 (42%)
C2H2 Zn finger 221..239 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.