DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and PLAGL2

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_002648.1 Gene:PLAGL2 / 5326 HGNCID:9047 Length:496 Species:Homo sapiens


Alignment Length:236 Identity:65/236 - (27%)
Similarity:91/236 - (38%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   828 VVCPECKSSN--FSNWNCLHTHLWRTHQIDMELYSC-QLCSFKTPIYSRLVNTHAKIHSEERNYK 889
            |.| :|:.|.  |||...|..|  ...|.:...||| ||...|.......:..|...||.::.::
Human    38 VKC-QCEISGTPFSNGEKLRPH--SLPQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQ 99

  Fly   890 CEQCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNEQISVGPEGNPVVMHRCEDCGAAFKQKKTLRE 954
            |..|.|.|.....|:||.:.|                   :.|...:| |.:||..:..|...|.
Human   100 CMYCDKMFHRKDHLRNHLQTH-------------------DPNKEALH-CSECGKNYNTKLGYRR 144

  Fly   955 HLCKE--RNEQLECPECQRRFGSKSSLRLHLRSHQ-------EHKRFRCDTCDHETSDHNAYRRH 1010
            ||...  .:..|.|..|.:.|.|..:|..||::|.       :.|:..||.||.........|||
Human   145 HLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRH 209

  Fly  1011 LATHKESKRYSCPHCDFRAIQSTAFRIHLQTRHPEQELSTI 1051
            |..|...|.:.|.:|..|..:......|::..| .|||..|
Human   210 LVVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSH-SQELLKI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 8/23 (35%)
C2H2 Zn finger 861..882 CDD:275368 5/21 (24%)
zf-H2C2_2 875..899 CDD:290200 7/23 (30%)
zf-C2H2 888..910 CDD:278523 7/21 (33%)
C2H2 Zn finger 890..910 CDD:275368 7/19 (37%)
zf-C2H2_2 893..999 CDD:289522 29/114 (25%)
C2H2 Zn finger 939..956 CDD:275368 5/16 (31%)
RPB9 966..1061 CDD:224510 28/93 (30%)
C2H2 Zn finger 966..986 CDD:275368 7/19 (37%)
C2H2 Zn finger 994..1014 CDD:275368 8/19 (42%)
C2H2 Zn finger 1022..1042 CDD:275368 4/19 (21%)
C2H2 Zn finger 1055..1075 CDD:275368
PLAGL2NP_002648.1 C2H2 Zn finger 70..92 CDD:275368 5/21 (24%)
zf-H2C2_2 85..109 CDD:404364 7/23 (30%)
C2H2 Zn finger 100..120 CDD:275368 7/19 (37%)
C2H2 Zn finger 129..149 CDD:275368 7/19 (37%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 193..213 CDD:275368 8/19 (42%)
C2H2 Zn finger 221..239 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.