DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and CG11456

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001262130.1 Gene:CG11456 / 40309 FlyBaseID:FBgn0037031 Length:445 Species:Drosophila melanogaster


Alignment Length:414 Identity:99/414 - (23%)
Similarity:160/414 - (38%) Gaps:108/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   683 NAEEGTAAGGRGTVPPLVPVTSSEGTASVAQSAALGSLPVPPLVPLAAEMNAAIEKPARIYVANN 747
            :.:|.||||           ::|:...:|.:.:.....|...|.|:..       |..|:.:..|
  Fly    50 STKEQTAAG-----------SNSQDKQTVVERSENSEPPASELQPMPF-------KDFRLVLRAN 96

  Fly   748 LLPAAVDPPLLGGGTSVRGRPYGAKHSGGAASKRKLSLGPNQVPEGGKCLVEGCMFRFKSPVTLE 812
            :|    :|...|                                       :.|.|:|:....:|
  Fly    97 ML----EPCSFG---------------------------------------KECPFKFQDATKME 118

  Fly   813 YHGRCHNGSLSSNQPVVCPECKSSNFSNWNCLHTHLWRTHQIDMELYSCQL--CSFKTPIYSRLV 875
            .|..||.|...|     |.|| .....||.....|||:.||:|::|..|.:  |::|:|| |.||
  Fly   119 LHCSCHKGGSFS-----CCEC-GMELPNWRRCSAHLWKAHQVDVDLLVCPVFECNYKSPI-SALV 176

  Fly   876 NTHAKIHSEERNYKCEQCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNEQISVGPEGNPVVMHR-- 938
            ..|.::|.:.|       .:..::...::..|:|         |:.:.:::..|...|....:  
  Fly   177 WRHMQVHKKWR-------PRVLRSLAAVQRRRKL---------KEQSAEMAAQPAALPPSSKKNK 225

  Fly   939 ------CEDCGAAFKQKKTLREHLCKERN--EQLECPECQRRFGSKSSLRLHLRSHQEHKRFRCD 995
                  ||.|...|...|||.:|:....|  :...|..|.::...|:||.:|:|.|...|..:|.
  Fly   226 YYAEKTCEICNRKFVNGKTLSKHVKTVHNKIKPFICNVCGKKTARKASLIIHMRQHTGEKPLQCG 290

  Fly   996 TCDHETSDHNAYRRHLATHKESKRYS---CPHCDFRAIQSTAFRIHLQTRHPEQELSTIIYK--- 1054
            .|...|.|.:...:|...|......|   |..||:..||:.|.:.|::..|.|      .|:   
  Fly   291 ECKFSTRDPSVLHKHRQRHDSQDTRSSLKCSQCDYFCIQANALKRHMRLNHAE------AYRDLC 349

  Fly  1055 CNQCNFTSINQGLLQVHQAKHDAG 1078
            |:.|:|||||...|:.|:..|..|
  Fly   350 CDICSFTSINVERLRAHKQDHRQG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 8/21 (38%)
C2H2 Zn finger 861..882 CDD:275368 9/22 (41%)
zf-H2C2_2 875..899 CDD:290200 4/23 (17%)
zf-C2H2 888..910 CDD:278523 1/21 (5%)
C2H2 Zn finger 890..910 CDD:275368 1/19 (5%)
zf-C2H2_2 893..999 CDD:289522 25/115 (22%)
C2H2 Zn finger 939..956 CDD:275368 7/16 (44%)
RPB9 966..1061 CDD:224510 28/100 (28%)
C2H2 Zn finger 966..986 CDD:275368 7/19 (37%)
C2H2 Zn finger 994..1014 CDD:275368 5/19 (26%)
C2H2 Zn finger 1022..1042 CDD:275368 7/19 (37%)
C2H2 Zn finger 1055..1075 CDD:275368 9/19 (47%)
CG11456NP_001262130.1 C2H2 Zn finger 232..253 CDD:275368 8/20 (40%)
C2H2 Zn finger 261..281 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24408
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.