DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and C04F5.9

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_504371.1 Gene:C04F5.9 / 178899 WormBaseID:WBGene00015451 Length:534 Species:Caenorhabditis elegans


Alignment Length:496 Identity:92/496 - (18%)
Similarity:151/496 - (30%) Gaps:188/496 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 KCLVEGCMFRFKSPVTLEYHGRCHNGSLSSNQPVVCPECKSSNFSNWNCLHTHLWRTHQIDMELY 859
            :||:|   |.|.|  .|:.|...|   |.:....:|..| .:.|:..:.|..| ||.....:::.
 Worm     9 QCLLE---FPFAS--KLQRHLETH---LITGGDWLCGLC-DTLFNRSSSLTNH-WRNSCAKVKMA 63

  Fly   860 SCQ-----------------------------------LCSFKTP--------IYSRL------V 875
            .|.                                   ..|:||.        ||..|      :
 Worm    64 FCDDELKEMLVYDLREAVFRMTLDHYSASEKSPEEPGTSSSYKTASDDKTSICIYCNLLMPRGTL 128

  Fly   876 NTHAKIHSEE-------RN----YKCEQCGKGFKNTKQLKNHRRLHRTQGLGM----GKQSNEQI 925
            :.|..:|:..       :|    |.|:.||.||:..|.|.||.|...|:.|..    |...|:::
 Worm   129 HHHYSVHTGRCCPAEITQNSVVPYVCDLCGFGFRYKKSLYNHWRHKCTEVLAHFPDGGNIENQEL 193

  Fly   926 SVGPEG--------NPVVMH--------RCEDCGAAFKQKKT--------------LREHLCKER 960
            :|..|.        ||:.:.        ..||.|.....::|              |::...:..
 Worm   194 NVMVEDLVKRAEVINPIELPSKRDGEDIEKEDSGDIDDDEETSPYFTAPITALSFDLQDWNVENV 258

  Fly   961 NEQLECPECQRRFGSKSSLRLHLRSHQEHKR--FRCDTCDHETSDHNAYRRHLAT---------- 1013
            :...|||:|.|.|.|...|..|..:.....|  |.|..|..:.:::.....||.:          
 Worm   259 SSTEECPKCNRYFHSLGRLDQHTHAFHGTARPGFVCKLCRMKFAENRILLAHLRSGCKPMRVEVP 323

  Fly  1014 -HKESKRYSCPHCDFRAIQS--------------------TAFRIHLQTRHPEQ----------- 1046
             .|:.|:.|.... .:.:::                    ..|...:..|.|..           
 Worm   324 DEKKRKKMSAEEL-MKVVENEKSTWIELFENKKAANLKFIKEFLDQIDRRKPHGYASSQIVLNRP 387

  Fly  1047 ------ELSTIIYKCNQCNFTSINQGLLQVH-QAKHDAG---NHNQTLASSQGDVP--------- 1092
                  |:.|.:..|..|..|..:...|..| |..|...   :.||...::...:|         
 Worm   388 VPAHSIEIDTKMNSCRLCKITFKSSRFLYQHEQTVHQREPPVHRNQLTITATSLLPYFKFQEAKF 452

  Fly  1093 -------------VEKQSQIKV-------ESNLVLAHSSTK 1113
                         :||.:.|.|       ::|:|..|.:.|
 Worm   453 YDSSGQEYRMGKYLEKNNGINVSRNVKKQKNNIVTLHGNLK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 7/21 (33%)
C2H2 Zn finger 861..882 CDD:275368 8/69 (12%)
zf-H2C2_2 875..899 CDD:290200 9/34 (26%)
zf-C2H2 888..910 CDD:278523 11/21 (52%)
C2H2 Zn finger 890..910 CDD:275368 10/19 (53%)
zf-C2H2_2 893..999 CDD:289522 35/141 (25%)
C2H2 Zn finger 939..956 CDD:275368 5/30 (17%)
RPB9 966..1061 CDD:224510 24/144 (17%)
C2H2 Zn finger 966..986 CDD:275368 8/19 (42%)
C2H2 Zn finger 994..1014 CDD:275368 4/30 (13%)
C2H2 Zn finger 1022..1042 CDD:275368 1/39 (3%)
C2H2 Zn finger 1055..1075 CDD:275368 6/20 (30%)
C04F5.9NP_504371.1 C2H2 Zn finger 7..27 CDD:275368 8/22 (36%)
C2H2 Zn finger 36..54 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.