DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and M03D4.4

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:272 Identity:67/272 - (24%)
Similarity:100/272 - (36%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   859 YSCQLCSFKTPIYSRLVNTHAKIHSEERNYKCEQCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNE 923
            |.|:.|.....: .|.:.||.:|||.|:.:.|.||||.|...:.||.|...|      .|::|  
 Worm    88 YECEDCHEMFAV-KRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWH------TGERS-- 143

  Fly   924 QISVGPEGNPVVMHRCEDCGAAFKQKKTLREHL-CKERNEQLECPECQRRFGSKSSLRLHLRSHQ 987
                         |.|..|..||.||..|.:|| ........|||:|.:.|..|..|..|::.||
 Worm   144 -------------HVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQCHKTFIFKFDLNRHMKIHQ 195

  Fly   988 EHKRFRCDTCDHETSDHNAYRRHLATHKESKRYSCPHCDFRAIQSTAFRIHLQTR---HPEQELS 1049
            | :.|.|..|............|   |.:.|  ..|....|::.:...:..|::.   .|.|| |
 Worm   196 E-RGFSCQQCGRSFLKQVMLDEH---HLKCK--GKPSSPIRSLLTPTMKAGLESAISIKPPQE-S 253

  Fly  1050 TIIYKCNQCNFTSINQGLLQVHQAKHDAGNHNQTLASSQGDVPVEKQSQIKVESNLVLAHSSTKV 1114
            .|:                           .::|:|.....:.:::|...:...|.:|       
 Worm   254 MIL---------------------------SSETIAKMAQKLLIQQQENHRNALNTLL------- 284

  Fly  1115 ATEVIKAQENIL 1126
                :|..||||
 Worm   285 ----VKQHENIL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368
C2H2 Zn finger 861..882 CDD:275368 5/20 (25%)
zf-H2C2_2 875..899 CDD:290200 12/23 (52%)
zf-C2H2 888..910 CDD:278523 9/21 (43%)
C2H2 Zn finger 890..910 CDD:275368 9/19 (47%)
zf-C2H2_2 893..999 CDD:289522 34/106 (32%)
C2H2 Zn finger 939..956 CDD:275368 7/16 (44%)
RPB9 966..1061 CDD:224510 24/97 (25%)
C2H2 Zn finger 966..986 CDD:275368 7/19 (37%)
C2H2 Zn finger 994..1014 CDD:275368 3/19 (16%)
C2H2 Zn finger 1022..1042 CDD:275368 3/19 (16%)
C2H2 Zn finger 1055..1075 CDD:275368 0/19 (0%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 5/20 (25%)
zf-H2C2_2 102..127 CDD:290200 12/24 (50%)
C2H2 Zn finger 118..138 CDD:275368 9/19 (47%)
C2H2 Zn finger 146..166 CDD:275368 9/19 (47%)
zf-H2C2_2 158..181 CDD:290200 7/22 (32%)
zf-C2H2 172..194 CDD:278523 8/21 (38%)
C2H2 Zn finger 174..194 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.