DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1233 and ZBTB49

DIOPT Version :9

Sequence 1:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster
Sequence 2:NP_001317554.1 Gene:ZBTB49 / 166793 HGNCID:19883 Length:765 Species:Homo sapiens


Alignment Length:582 Identity:136/582 - (23%)
Similarity:208/582 - (35%) Gaps:153/582 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 KQKIF---IKNV----DILKAPQRGTLHLRTVDELNLMNRTEVEHLIVPNLEPMAMTMMELPPVQ 586
            |..:|   :|||    .||.......|.|.. |.:.:|..| .:.|.|.|:..:..|.::...|.
Human    61 KNDVFHLDVKNVSGIGQILDFMYTSHLDLNQ-DNIQVMLDT-AQCLQVQNVLSLCHTFLKSATVV 123

  Fly   587 QQP-MEVTSQLKGPTETLGEFQPSISESWPSEDGYDLPEDLECWPWMEDAVPEAGLVLPTPS--- 647
            |.| |...|.|...:....:....|||::|.....:...|.:....::::.|.|     :||   
Human   124 QPPGMPCNSTLSLQSTLTPDATCVISENYPPHLLQECSADAQQNKTLDESHPHA-----SPSVNR 183

  Fly   648 -----EVANAPPLDGLSHNAVDLLVKD----------FS---HLYAAPPEDTQNAEEGTAAGGRG 694
                 |::...| |....:..:|..|.          :|   |.:||.|...:..|:        
Human   184 HHSAGEISKQAP-DTSDGSCTELPFKQPNYYYKLRNFYSKQYHKHAAGPSQERVVEQ-------- 239

  Fly   695 TVPPLVPVTSSEGTASVAQSAALGS----LPVPPLVP---LAAEMN---------AAIEKPAR-- 741
               |....||::.|...:|..|:..    |..|..:|   ||..:|         |..::|.:  
Human   240 ---PFAFSTSTDLTTVESQPCAVSHSECILESPEHLPSNFLAQPVNDSAPHPESDATCQQPVKQM 301

  Fly   742 -----IYVAN-NLLPA-----AVDPPLLGGGTSVRGRPYGAKHSGGAASKRKLSLGPNQVP---- 791
                 |::.. |.|.:     .|..|....|.:.|..         :|||..|....:|..    
Human   302 RLKKAIHLKKLNFLKSQKYAEQVSEPKSDDGLTKRLE---------SASKNTLEKASSQSAEEKE 357

  Fly   792 -------EGGKCLVEG--------------------------CMFRFKSPVTLEYHGRCHNGSLS 823
                   |...|:.|.                          |...||.|..||.|.|.|.|   
Human   358 SEEVVSCENFNCISETERPEDPAALEDQSQTLQSQRQYACELCGKPFKHPSNLELHKRSHTG--- 419

  Fly   824 SNQPVVCPECKSSNFSNWNCLHTHLWRTHQIDMELYSCQLCSFKTPIYSRLVNTHAKIHSEERNY 888
             .:|..|..| ..:||....|.||| |.|..: :.|.|::|. |....|..|..|..|||.|:.:
Human   420 -EKPFECNIC-GKHFSQAGNLQTHL-RRHSGE-KPYICEICG-KRFAASGDVQRHIIIHSGEKPH 479

  Fly   889 KCEQCGKGFKNTKQLKNHRRLHRTQGLGMGKQSNEQISVGPEGNPVVMHRCEDCGAAFKQKKTLR 953
            .|:.||:||.|...||.|::.|...                     .:..|::||.:|..::.|.
Human   480 LCDICGRGFSNFSNLKEHKKTHTAD---------------------KVFTCDECGKSFNMQRKLV 523

  Fly   954 EHLCKERNEQ-LECPECQRRFGSKSSLRLHLRSHQEHKRFRCDTCDHETSDHNAYRRHLATH 1014
            :|..:...|: ..|..|.:.||....||.|:|:|...|.:.|:.|:...:.....|||...|
Human   524 KHRIRHTGERPYSCSACGKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMH 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 9/21 (43%)
C2H2 Zn finger 861..882 CDD:275368 6/20 (30%)
zf-H2C2_2 875..899 CDD:290200 11/23 (48%)
zf-C2H2 888..910 CDD:278523 9/21 (43%)
C2H2 Zn finger 890..910 CDD:275368 9/19 (47%)
zf-C2H2_2 893..999 CDD:289522 28/106 (26%)
C2H2 Zn finger 939..956 CDD:275368 5/16 (31%)
RPB9 966..1061 CDD:224510 16/49 (33%)
C2H2 Zn finger 966..986 CDD:275368 8/19 (42%)
C2H2 Zn finger 994..1014 CDD:275368 5/19 (26%)
C2H2 Zn finger 1022..1042 CDD:275368
C2H2 Zn finger 1055..1075 CDD:275368
ZBTB49NP_001317554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 7/43 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..294 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.