DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc5 and NSI1

DIOPT Version :9

Sequence 1:NP_001163313.1 Gene:Cdc5 / 38062 FlyBaseID:FBgn0265574 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_010309.3 Gene:NSI1 / 851590 SGDID:S000002433 Length:570 Species:Saccharomyces cerevisiae


Alignment Length:349 Identity:66/349 - (18%)
Similarity:115/349 - (32%) Gaps:113/349 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEDE 69
            :|:.|.|.|.                 |::.....|.|..:...|.|...:   ::.:|:.|||:
Yeast   310 VIRDGFWANI-----------------SKVLPYRTRSSIYKHIRRKYHIFE---QRGKWTPEEDQ 354

  Fly    70 KLLHLAKLMPTQWRTIAPIIGRTAAQCLERYEYLLDQAQRKEDGEDTMDDPRKLKPGEIDPNPET 134
            :|..|.......|..:..::||....|.:|:.                   ..:|.|        
Yeast   355 ELARLCLEKEGHWTEVGKLLGRMPEDCRDRWR-------------------NYMKCG-------- 392

  Fly   135 KPARPDPKDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLATLQKRRELRAAGIGSG 199
              ::...|...::|.|:|:    .:.|...::|.:..|.|.||.|.:   ..:..::.:.|   .
Yeast   393 --SKRGSKRWSKEEEELLT----TVVNEMIEEAHQYQRMKALEAANK---NDRYNQMYSRG---P 445

  Fly   200 NRKRIKGIDYNAEIPFEKRPAHGFYDTSEEHLQKNEPDFNKMRQQDLDGELRSEKEERERKRDKQ 264
            ..|||                            .:.|.|..|    ::..:.||:....|.|.:.
Yeast   446 KGKRI----------------------------SDNPTFKDM----INWTVVSERMSGTRSRIQC 478

  Fly   265 KLKQRK--ENEVPTAMLQNMEPERK----RSKLVLPTPQISDMELQQVV--KLG----------- 310
            :.|..|  .:|...:||.....|||    |.| .||....|:::...:.  |.|           
Yeast   479 RYKWNKLVTDEAARSMLSIPVSERKWLLERLK-QLPKTSYSNIDWNSIATYKPGYPRTGLELRLC 542

  Fly   311 --RASEMAKEIAGESGIETTDALL 332
              :..|...:..|.|..|..|:||
Yeast   543 YEQMREKIHDFKGRSTAEIIDSLL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc5NP_001163313.1 SANT 8..56 CDD:197842 8/47 (17%)
Myb_DNA-bind_6 11..71 CDD:290632 11/59 (19%)
SANT_CDC5_II 56..108 CDD:212557 11/51 (22%)
SANT 60..104 CDD:197842 11/43 (26%)
Myb_Cef 397..648 CDD:288664
NSI1NP_010309.3 REB1 53..567 CDD:227476 66/349 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.