DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc5 and MYB113

DIOPT Version :9

Sequence 1:NP_001163313.1 Gene:Cdc5 / 38062 FlyBaseID:FBgn0265574 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_176811.1 Gene:MYB113 / 842955 AraportID:AT1G66370 Length:246 Species:Arabidopsis thaliana


Alignment Length:153 Identity:42/153 - (27%)
Similarity:69/153 - (45%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKGGVWRNTEDEILKAAVMKYGKNQWSRI--ASLLHRKSAKQCKARWYEWLDPSIKKTEWSREED 68
            ::.|.|...||.:|:..:.|||:.:|.|:  .:.|:| ..|.|:.||..:|.||||:.:...:|.
plant     8 LRKGTWTTEEDILLRQCIDKYGEGKWHRVPLRTGLNR-CRKSCRLRWLNYLKPSIKRGKLCSDEV 71

  Fly    69 EKLLHLAKLMPTQWRTIA-PIIGRTAAQCLERYEYLLDQAQRKEDGEDTMDDPRKLKPGEIDPNP 132
            :.:|.|.||:..:|..|| .:.||||......:...|.:..          |.|..|...|:.|.
plant    72 DLVLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKH----------DERCCKTKMINKNI 126

  Fly   133 ETKPA---------RPDPKDMDE 146
            .:.|.         :|.|:...:
plant   127 TSHPTSSAQKIDVLKPRPRSFSD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc5NP_001163313.1 SANT 8..56 CDD:197842 17/49 (35%)
Myb_DNA-bind_6 11..71 CDD:290632 21/61 (34%)
SANT_CDC5_II 56..108 CDD:212557 17/52 (33%)
SANT 60..104 CDD:197842 12/44 (27%)
Myb_Cef 397..648 CDD:288664
MYB113NP_176811.1 PLN03212 7..>111 CDD:178751 34/103 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.