DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc5 and MYB42

DIOPT Version :9

Sequence 1:NP_001163313.1 Gene:Cdc5 / 38062 FlyBaseID:FBgn0265574 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_567390.4 Gene:MYB42 / 826844 AraportID:AT4G12350 Length:286 Species:Arabidopsis thaliana


Alignment Length:166 Identity:41/166 - (24%)
Similarity:69/166 - (41%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLH-RKSAKQCKARWYEWLDPSIKKTEWSRE 66
            ::|:|.|.|...||:.|...::..|...|..:..|.. |:..|.|:.||..:|.|.:|:...|..
plant     9 KLMVKKGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYLRPDLKRGLLSDA 73

  Fly    67 EDEKLLHLAKLMPTQWRTIAP-IIGRTAAQCLERYEYLLDQAQRKEDGEDTMDDPRKLKPGEIDP 130
            |::.::.|..|:..:|..||. :.|||..:....:...:               .:||...||||
plant    74 EEQLVIDLHALLGNRWSKIAARLPGRTDNEIKNHWNTHI---------------KKKLLKMEIDP 123

  Fly   131 NPETKPARPDPKDMDEDELEMLSEARARLANTQGKK 166
            :..    :|..|...:..|...||..::..|....|
plant   124 STH----QPLNKVFTDTNLVDKSETSSKADNVNDNK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc5NP_001163313.1 SANT 8..56 CDD:197842 14/48 (29%)
Myb_DNA-bind_6 11..71 CDD:290632 17/60 (28%)
SANT_CDC5_II 56..108 CDD:212557 12/52 (23%)
SANT 60..104 CDD:197842 10/44 (23%)
Myb_Cef 397..648 CDD:288664
MYB42NP_567390.4 SANT 14..63 CDD:197842 14/48 (29%)
Myb_DNA-binding 14..61 CDD:278669 13/46 (28%)
Myb_DNA-binding 67..112 CDD:278669 10/44 (23%)
SANT 71..114 CDD:197842 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.