DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc5 and ttf1.6

DIOPT Version :9

Sequence 1:NP_001163313.1 Gene:Cdc5 / 38062 FlyBaseID:FBgn0265574 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_005168698.1 Gene:ttf1.6 / 449954 ZFINID:ZDB-GENE-041008-214 Length:549 Species:Danio rerio


Alignment Length:628 Identity:111/628 - (17%)
Similarity:208/628 - (33%) Gaps:209/628 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 DELEMLSEARARLANTQGKKAKRKAREK-------QLEEARRLATLQK-RRELRAAGIGSGNRKR 203
            ||:..|| :.||:...:.||.:.|..|:       |.:..:||...:| |..:|...|....:||
Zfish     2 DEMPSLS-SNARVDGEKVKKKRSKPTEQHELTESPQEQAEKRLKKKEKMRNSIRETDINLQIKKR 65

  Fly   204 IKGIDYNAEIPFEKRPAHGFYDTSEEHLQKNEPDFNKMRQQDLDGELRSEKEERERKRDKQKLKQ 268
            .| :|...|.|.               |.....:.::.:.|:|.|.  .|.:..:||:.::||||
Zfish    66 RK-LDDEGETPV---------------LDDGVSNQHEAQTQELQGS--REGKTSKRKKMREKLKQ 112

  Fly   269 RKENEV---PTAMLQNMEPERKRSKLVLPTPQISDMELQQV-VKLGRASEMAKEIAGESGIETTD 329
            ....::   .|.:.:..|.|          |..||.|...: :.:|..:...|::..:..:...:
Zfish   113 TNCEDMAKQQTDIRREHEDE----------PNTSDHERGLLDIMMGTKTRKTKQLLSDEPLVDLN 167

  Fly   330 ALLADYSITPQVAATPRTPAPYTDRIMQEAQNMMALTHTETPLKGGLNTPLHESDFSGVLPKAAS 394
            ||.......|::....|:        .::...|:.:.                      ||:...
Zfish   168 ALDELNQFCPKITLASRS--------ARDINKMIRID----------------------LPRFKE 202

  Fly   395 IATPNTVIATPFRTQREGGAATPGGFQTPSSGAL-VPVKGAGGATGVVNTPAYVRDKLSINPEES 458
                       ||  ::|.....|.|.|..:..| ..|......||       |:|.:.:     
Zfish   203 -----------FR--KQGIELRHGRFSTAENERLRQNVSNFLALTG-------VKDAIKL----- 242

  Fly   459 MGVTETPAHYKNYQKQLKSTLRDGLSTLPAPRNDYEIVVPEQEESERIETNSEPAVEDQADVDAR 523
                   .|.|.:.|:.:        ||...:..|...|.                         
Zfish   243 -------FHPKRFPKESQ--------TLANLKRKYSFFVK------------------------- 267

  Fly   524 LLAEQEARRKRELEKRSQVIQRSLPRPTE----VNTKILRPQSEKQNLTEQQQAEELIKHEMITM 584
                               |...:|||..    ..|||...:::|.|.||::: :.|:|:..:..
Zfish   268 -------------------IAEGIPRPCHDVYTRGTKIYDDRNKKGNFTEEEE-KSLLKYYTLYG 312

  Fly   585 QLYDSVKDPVPGQSQHKLEQLQSYFK--ANPYEDISQQELAKA----------------KQMLTE 631
            ..:..:.|.. .:|.:.||:..|:..  ..|:.....|.|.:|                |:....
Zfish   313 PDWKKISDKT-DRSSYSLEKRFSHLSKIRGPWTTNEVQRLLRAVRDHVVSVLKSANPKKKKPKRV 376

  Fly   632 EMEVVKERMAHGELPLDVYAQVWQECLGQVLYLPSQHRYTRANLASKKDRLESAEKRLETNRRHM 696
            ..|::.:.:...::...|..:.|.:|..:.:.:          |||   |:.|.    .|.|...
Zfish   377 SREILYQALPWSKIAEKVKTRCWTKCRDKWMSI----------LAS---RMSSG----ITFRGRK 424

  Fly   697 AKEAKRCGKIEKKLKILTGGYQARAQVLI----KQLQDTYGQI 735
            |:||        |:|::...|:.:.:.::    :.|...:|.:
Zfish   425 AQEA--------KIKLIRAMYEMQVEDVVDVDWEHLTAVFGDV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc5NP_001163313.1 SANT 8..56 CDD:197842
Myb_DNA-bind_6 11..71 CDD:290632
SANT_CDC5_II 56..108 CDD:212557
SANT 60..104 CDD:197842
Myb_Cef 397..648 CDD:288664 43/273 (16%)
ttf1.6XP_005168698.1 Myb_DNA-bind_6 296..351 CDD:290632 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.