DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc5 and Pbp95

DIOPT Version :9

Sequence 1:NP_001163313.1 Gene:Cdc5 / 38062 FlyBaseID:FBgn0265574 Length:814 Species:Drosophila melanogaster
Sequence 2:NP_649760.1 Gene:Pbp95 / 40949 FlyBaseID:FBgn0037540 Length:721 Species:Drosophila melanogaster


Alignment Length:623 Identity:126/623 - (20%)
Similarity:219/623 - (35%) Gaps:221/623 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WSRIAS--LLHRKSAKQCKARWYEWLDPSIKKTEWSREEDEKLLHLAKLMPTQ-WRTIAPIIGRT 92
            |::|::  |.:|.|...|:|.|..:|.|.:::.:||.||||.||.:|.....| |..||..:.|.
  Fly   198 WNQISTLDLEYRHSPYSCEAMWRVYLTPDLRRDDWSPEEDETLLAVATANRMQNWELIAASLDRR 262

  Fly    93 A-AQCLERY----EYLLDQAQRKEDGEDTMDDPRKLKPGEIDPNPETKPAR--------PD---- 140
            : .||..|:    .:||:........|:..|..|.:    :|.|.......        ||    
  Fly   263 SDYQCFVRFHTALRFLLEPKNSHRWSEEDNDKLRAI----VDRNTANSVINWKKVVEYFPDKSKS 323

  Fly   141 -----------------PKDMDEDEL----------------------EMLSEARARLANTQGKK 166
                             |....||.:                      ..|::.|.|..|...::
  Fly   324 TLIGRYYYVLHPSISHEPFTTKEDMMLFAAVEEYNGKFHCFPRSLFPNRSLTQLRTRYHNVLAQR 388

  Fly   167 AKRKAREKQLEEARRLATLQK---RRELRAAGIGSGNRKRIKGIDYNAEIPFEKRPAHGFYDTS- 227
            .|..:...| ::.|.::.:.:   .:.|..|.. .||..|                      || 
  Fly   389 NKTDSWSVQ-DDTRLMSFVTQYGASQWLNCATF-LGNHTR----------------------TSC 429

  Fly   228 -------EEHLQKNEPDFNKMRQQDLDGELRSEKEERERKRDK-----------QKLKQRKENEV 274
                   ::.|::|.               .::.|:..|:|.|           |:|::.:|:  
  Fly   430 RTRFLVIKKFLEQNP---------------NAKVEDLPRRRSKKVSLVNSDNWAQRLQEWQED-- 477

  Fly   275 PTAMLQNMEPERKRSKLVLPTPQISDMELQQVVKLGRASEMAKEIAGESGIETTDALLADYSITP 339
            |.:::.:..|  |.:::..|..:.:.:| :|.....|.|::        .||..:.....|::| 
  Fly   478 PESLVNDNPP--KGTRVRGPKSKKARIE-RQAESFSRLSKV--------DIEFCNFFKFSYNLT- 530

  Fly   340 QVAATPRT-PAPYTDRIMQEAQNMMALTHTETPLKGGL-------------------NTPLHESD 384
              .:||:| |.|  ..:...|..:.||.: :.|::..|                   |.|..|.|
  Fly   531 --LSTPKTFPVP--KDVYNLAYVIRALAY-KPPIRPSLLQNIFMPNDVLKCYNSMIRNLPDEEGD 590

  Fly   385 F-SGVLPKAASIATPNTVIATPFRTQREGGAATPGGFQTPSSGALVPVKGAGGATGVVNTPAYVR 448
            . |.:||       ||.              :|..||:     ||..:  :|.......|.::..
  Fly   591 MKSPLLP-------PNW--------------STMMGFR-----ALCIL--SGDCRKDTETRSFEY 627

  Fly   449 DKLSINPEESMGVTETPAHYK-----NYQKQLKSTLRDGLSTLPAPRNDY-------EIVVPEQE 501
            :: |:.|.:..........|:     ..:.||.:.|...|.:||.|::||       |::.|   
  Fly   628 NE-SLPPIQLFRKRLQALFYRTTLLSRLESQLFTDLPSALVSLPRPKHDYAKMGTHVELIDP--- 688

  Fly   502 ESERIETNSEPAVEDQADVDARLLAEQEARR--KRELE 537
                     |||  .|.|:.:..|:|.|...  |:|||
  Fly   689 ---------EPA--PQNDLKSEPLSENEVINTVKQELE 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc5NP_001163313.1 SANT 8..56 CDD:197842 9/26 (35%)
Myb_DNA-bind_6 11..71 CDD:290632 16/41 (39%)
SANT_CDC5_II 56..108 CDD:212557 20/57 (35%)
SANT 60..104 CDD:197842 17/49 (35%)
Myb_Cef 397..648 CDD:288664 35/155 (23%)
Pbp95NP_649760.1 DUF883 4..>74 CDD:295076
SANT <194..240 CDD:304392 16/41 (39%)
SANT 229..276 CDD:197842 17/46 (37%)
Myb_DNA-binding 229..275 CDD:278669 17/45 (38%)
Myb_DNA-bind_6 287..350 CDD:290632 10/66 (15%)
SANT 392..438 CDD:197842 9/69 (13%)
Myb_DNA-binding 393..437 CDD:278669 9/67 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.