DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and ezrb

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_001025456.1 Gene:ezrb / 561589 ZFINID:ZDB-GENE-050803-1 Length:583 Species:Danio rerio


Alignment Length:500 Identity:123/500 - (24%)
Similarity:202/500 - (40%) Gaps:102/500 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQKPGDVVRWVDAQKQFKKQCSSVSLDNDAVPL 112
            |.::....|.:|.|||.:.:.|.|..||||.:....| .:.|:...|:...|  .|..:|   ||
Zfish    18 FAVQPSTTGKQLFDQVVKTIGLREIWYFGLQYMDSKG-YLTWLKLDKKVSSQ--DVKKEN---PL 76

  Fly   113 -LEFRVKFFVSD-PSRLQEEFTRYQFYLQIKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALE 175
             .:||.|||..| ...|.::.|:..|::|:|..||..::.|...|..|||||:||::.|||:...
Zfish    77 QFKFRAKFFPEDVADELIQDITQKLFFMQVKDGILSDEIYCPPETAVLLASYSVQAKFGDFSKEL 141

  Fly   176 HQPGYLSGMQLLCDQTTEA--------ERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLH 232
            |:||||:..:||..:..:.        |.::...|:.|||.|..||...||:.|:.||:||::..
Zfish   142 HRPGYLTSERLLPQRVLDQHKLSREQWEERIQVWHEEHRGMLREDAMLEYLKIAQDLEMYGVNYF 206

  Fly   233 RATDSNGKELQLGVSAVGLLVFQHSLRVNT---FSWSKMVKVSFKRKDFFIQLRREPSENYDTLL 294
            ...:..|.||.|||.|:||.:::...::..   |.||::..:||..|.|.|    :|.:......
Zfish   207 DIKNKKGTELWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVI----KPIDKKAPDF 267

  Fly   295 GFGMSSHKHAKALWKSCVEHHS-FFRLKRPHRLSRFLNISLGSKFYYSGRTELQAVQ-------- 350
            .|.....:..|.:.:.|:.:|. :.|.::|..:.       ..:.....|.|.|..|        
Zfish   268 VFYAPRLRINKRILQLCMGNHELYMRRRK
PDTIE-------VQQMKAQAREEKQQKQMERAQLEN 325

  Fly   351 ESKQRGRI--HKVFVRSPSKRLLGAAGGVGTSGSSGGTPMQQHSGSESANSHNNGKPAGAGTILT 413
            |.|:|..|  .|..:....|.|:                ||.:...|......|.........:.
Zfish   326 EKKRREAIEREKEQMEREKKELM----------------MQLYQFEERTKKVENELQEQMQRAMQ 374

  Fly   414 ITKTSRPHDNKVTSKEA---------DSMPRKAWEQQSDEYDIQLD-------VGFIEQCTRRFE 462
            :....|..|.:....||         :.:.|:|.:|...:..:..:       :..:|:..:|.|
Zfish   375 LQHERRLADEEAARLEAERQAALLAKEELARQAQDQLKSQEQLAAELAEYTAKISLLEEAKKRKE 439

  Fly   463 ----------------------------SASP-SPMPPAYSSGQH 478
                                        :|.| .|.||||...::
Zfish   440 EEAQTWQNKAQLAQDDLIKTRQELHNVMTAPPLPPPPPAYDHDEN 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604 67/193 (35%)
FERM_N 38..102 CDD:286467 16/53 (30%)
FERM_M 125..232 CDD:278785 41/114 (36%)
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010 24/97 (25%)
FA 333..369 CDD:285894 9/45 (20%)
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528
PTPc 668..955 CDD:238006
ezrbNP_001025456.1 B41 7..206 CDD:214604 67/193 (35%)
FERM_N 9..71 CDD:286467 16/55 (29%)
FERM_M 92..206 CDD:278785 41/113 (36%)
FERM_C_ERM 200..296 CDD:270015 25/99 (25%)
GBP_C <305..417 CDD:303769 22/127 (17%)
DUF106 <306..>350 CDD:303007 11/59 (19%)
ERM 338..583 CDD:279153 23/162 (14%)
coiled coil 387..398 CDD:293879 2/10 (20%)
coiled coil 407..417 CDD:293879 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.