DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Ptp99A

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster


Alignment Length:430 Identity:109/430 - (25%)
Similarity:165/430 - (38%) Gaps:151/430 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   574 RDCRHQASGELLLTVRPQRSAPLLLEEEPLYQYVPESD------------------EIGSHSNLL 620
            |.|.|              :|...|::.|.:...|:.|                  |...|...|
  Fly   589 RKCFH--------------AAYYYLDDPPHHPNAPQVDWEVPVKIGDEIRAAVPVNEFAKHVASL 639

  Fly   621 --DGDALFTQSLLLLSDGLASGALLAQYELMYRK--NPDLAITEARKPANAPKNRYRDISPYDCT 681
              |||..|::                :||.:..:  :.||....::.|.|..||||.:|:.||.:
  Fly   640 HADGDIGFSR----------------EYEAIQNECISDDLPCEHSQHPENKRKNRYLNITAYDHS 688

  Fly   682 RVSLVNSLTG-----DYINANYVNMEIPGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVMLT 741
            ||.| :...|     ||||||:::....|.|   :|.|||||..|...||||:.::...::||:|
  Fly   689 RVHL-HPTPGQKKNLDYINANFIDGYQKGHA---FIGTQGPLPDTFDCFWRMIWEQRVAIIVMIT 749

  Fly   742 TVMESGRQKCHQYWPVTGEEL-----------QLAEGFSVRCLSEKPDETGSFVFREFVLKDKHE 795
            .::|.||:||..|||..|.|.           ::...::||.|.          .:...||.|.:
  Fly   750 NLVERGRRKCDMYWPKDGVETYGVIQVKLIEEEVMSTYTVRTLQ----------IKHLKLKKKKQ 804

  Fly   796 ---QRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAARNRTLLQEIEESLKQVRLMDADADADEN 857
               ::.::...|..||||..|..|...|.|.::                                
  Fly   805 CNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKK-------------------------------- 837

  Fly   858 GGLMRERKCAASNGATPEDETPVSTSVHQCISAANP----PVIVHCSAGIGRTGVLILMDTALAL 918
                                          .|||||    |::||||||:||||..|::|..|..
  Fly   838 ------------------------------SSAANPAEAGPIVVHCSAGVGRTGTYIVLDAMLKQ 872

  Fly   919 MEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAA 958
            ::.:..|.....:|.:|.||..:||...||.|:.:.:..|
  Fly   873 IQQKNIVNVFGFLRHIRAQRNFLVQTEEQYIFLHDALVEA 912

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492 3/14 (21%)
Y_phosphatase 666..955 CDD:278528 88/311 (28%)
PTPc 668..955 CDD:238006 87/309 (28%)
Ptp99ANP_651691.4 FN3 140..236 CDD:238020
fn3 249..331 CDD:278470
FN3 342..437 CDD:238020
FN3 442..520 CDD:238020
PTPc 646..911 CDD:214550 94/356 (26%)
PTPc 676..911 CDD:238006 87/310 (28%)
PTPc 935..1186 CDD:214550
PTPc 963..1169 CDD:238006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.