DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Fit2

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_648947.1 Gene:Fit2 / 39907 FlyBaseID:FBgn0036688 Length:715 Species:Drosophila melanogaster


Alignment Length:314 Identity:64/314 - (20%)
Similarity:107/314 - (34%) Gaps:81/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VRWVDAQKQFKKQCSSVSLDNDAV---PLLEFRVKFFV-------SDPSRLQEEFTRYQFYLQIK 141
            |.|:|         ||:|:....:   ..|..|.|:|.       .|..|:.      |.|.|.|
  Fly   277 VGWLD---------SSLSIMEQGIREYDTLCLRFKYFTFFDLNPKCDQVRIN------QLYEQAK 326

  Fly   142 RNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQP---GYLSGMQLLC---DQTTEAERKVGE 200
            .::|..:|.|:.....:.|:...|..    :.::|.|   ...||::...   |...|.:..:.|
  Fly   327 WSVLNEELDCTEEESLMFAALQFQVN----HHVDHTPQGAAVDSGIETSSQENDNEDEIDSALKE 387

  Fly   201 LHKLHRG-----------QLPADAEY-NYLEHAKRLELYGI--------DLHRATDSNGKELQLG 245
            |.....|           ::|..::| .||: .:|..|.|.        |||.....|.::.:..
  Fly   388 LQITLEGPDYGGDSRNITRIPELSDYLRYLK-PQRFTLRGYKRYYFTYRDLHLHLFKNAEDSRRV 451

  Fly   246 VSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKDFFIQLRREPSENYDTLLGFGMSSHKHAKALWKS 310
            ..|:.         :|.........|:..:..:.|:|...|..      |.|::|.     :|..
  Fly   452 APAIS---------INLKGCEVTPDVNLSQGKYAIRLEVSPDG------GHGINSE-----VWVR 496

  Fly   311 CVEHHSFFRLKRPHRLSRFLNISLGSKFYYSGRTELQAVQESKQRGR-IHKVFV 363
            |.....:.:.....||:. ...||....|.|   |:.::....|..| .|.|.|
  Fly   497 CENEQQYAKWMAACRLAA-KGRSLADSSYES---EVDSILSLLQMQRPAHGVHV 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604 38/180 (21%)
FERM_N 38..102 CDD:286467 3/14 (21%)
FERM_M 125..232 CDD:278785 27/132 (20%)
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010 17/101 (17%)
FA 333..369 CDD:285894 10/32 (31%)
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528
PTPc 668..955 CDD:238006
Fit2NP_648947.1 B41 259..>351 CDD:214604 20/88 (23%)
FERM_M 310..>365 CDD:278785 13/64 (20%)
PH_fermitin 408..536 CDD:269943 29/152 (19%)
PH 408..515 CDD:278594 24/128 (19%)
FERM_M <557..609 CDD:278785
FERM_C_fermitin 603..693 CDD:270026
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.