DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and RhoGEF4

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster


Alignment Length:434 Identity:87/434 - (20%)
Similarity:147/434 - (33%) Gaps:143/434 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LARDKKTPQRQQCVTVLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLFPQKPGDVV 87
            |.:.:..|:.|:.:..|.:..|....|.:.      ||:||..|...::.||             
  Fly   181 LEQTESRPEVQRKLNSLMIVPIQRVPRYKL------LLEQVLLYTSPADADY------------- 226

  Fly    88 RWVDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRL-----QEEFTRYQFYLQIKRNILLG 147
                                   .||:..||...:..|.:     ::|.|:|..:||   |.|:.
  Fly   227 -----------------------KLLKESVKEIEATASHINTCVEEQEITQYLIHLQ---NSLVN 265

  Fly   148 KLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAER------KVGELHKLHR 206
            :.|     ..:..|..|..|           |.|   |.:..:.||.:|      .:....|:.:
  Fly   266 RTP-----NIVKPSRRVIKE-----------GVL---QKITHKGTEIKRYCVLMSDIFMYCKMIK 311

  Fly   207 GQLPADAEYNYLEHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKV 271
            .:.|.....|.||......|....::.....|.|   |...:.|::.....::::. :|     |
  Fly   312 ERAPNTVVENSLECCCIFPLKKCKVYEMLPGNFK---LTCQSDGIIFGSGDVQLSR-TW-----V 367

  Fly   272 SFKRK--DFFIQLR---------REPSENYDTLLGFG----MSSHKHAKALWKSCVEHHSFFRLK 321
            .|.|.  |..:|.|         |.|....| :..||    :|.:|      :.| |:.:.||.|
  Fly   368 GFIRDAIDLHVQCRKTLRKDSSKRTPIRKKD-MKKFGADYVLSPNK------RKC-EYDTVFRNK 424

  Fly   322 RPHRLSRFLNISLGSKFYYSGRTELQAVQESKQRGRIHKV---FVRSPSKRLLGAAGGVGTSGSS 383
                     |.|..|:         :..::|....|..||   .:|:|:...:|.|    :|.||
  Fly   425 ---------NRSTDSE---------EETEDSACFSRKRKVASGILRAPNGNPMGKA----SSSSS 467

  Fly   384 GGTPMQQHSGSESA--------NSHNNGKPAGAGTILTITKTSR 419
            ....|::.:....|        ..|..|:|   |.:.|.:|.:|
  Fly   468 SSVSMKRVAPPPPAPPPPPAVQMRHQPGRP---GELATASKENR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604 38/207 (18%)
FERM_N 38..102 CDD:286467 10/63 (16%)
FERM_M 125..232 CDD:278785 24/117 (21%)
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010 22/108 (20%)
FA 333..369 CDD:285894 8/38 (21%)
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528
PTPc 668..955 CDD:238006
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 18/104 (17%)
PH-like 269..>311 CDD:302622 10/55 (18%)
PH 277..374 CDD:278594 22/119 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.