DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Ptp61F

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:329 Identity:96/329 - (29%)
Similarity:137/329 - (41%) Gaps:92/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   652 KNPDLAITEARKPANAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEIPGGAVNRYIATQG 716
            |....:.:|:.:..|...|||||::|||.:|:.|... :.||||||.|.:|   .|..:||.|||
  Fly    46 KEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRG-SVDYINANLVQLE---RAERQYILTQG 106

  Fly   717 PLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWP---------------VTGEELQLAE 766
            ||..|...||.||.::.|..::||..:||..:.|||.|||               :|.|.::|  
  Fly   107 PLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPHVKLTVELVRL-- 169

  Fly   767 GFSVRCLSEKPDET-GSFVFREFVLKDKHEQ--RHIHHMQYLAWPDHCVPSDPNLFLEFTERVRA 828
                        || .:||.|.|.|.|...|  |.:....|..|||..:||.||.||:|.::|| 
  Fly   170 ------------ETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVR- 221

  Fly   829 ARNRTLLQEIEESLKQVRLMDADADADENGGLMRERKCAASNGATPEDETPVSTSVHQCISAANP 893
                                       ::|                            |:|....
  Fly   222 ---------------------------DSG----------------------------CLSRDVG 231

  Fly   894 PVIVHCSAGIGRTGVLILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAA 958
            |.:|||||||||:|...|:|..|.|::.........::..:|..|..::|...|..|..:.|...
  Fly   232 PAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMGLIQTADQLDFSYQAIIEG 296

  Fly   959 YMKI 962
            ..|:
  Fly   297 IKKL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528 92/306 (30%)
PTPc 668..955 CDD:238006 91/304 (30%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 95/322 (30%)
PTPc 62..295 CDD:238006 92/306 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443548
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.