DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Ptp36E

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_001286033.1 Gene:Ptp36E / 35091 FlyBaseID:FBgn0267486 Length:682 Species:Drosophila melanogaster


Alignment Length:372 Identity:103/372 - (27%)
Similarity:143/372 - (38%) Gaps:101/372 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 DEIGSHSNLLDGDALFTQSLLLLSDGLASGALLAQYELMYR-------KNPDLAITEARKPANAP 668
            ||..|.|..:....:..:..|.|.|      |..::.::|:       |........|.|..|..
  Fly    69 DENNSLSKTIPNGPIDIRHFLKLCD------LRRKFPVLYKLEFQTAAKVESNTCRHALKKNNLE 127

  Fly   669 KNRYRDISPYDCTRVSL--VNSL-TGDYINANYVNMEIPGGAVNRYIATQGPLASTTTDFWRMVQ 730
            ||:.....|||..||.|  |..| ..||:||:||:..:   ..|.||.||||:..|...:||||.
  Fly   128 KNQNPKCIPYDYNRVVLEKVGGLQDSDYVNASYVDSLL---KPNAYIVTQGPVEETVQAYWRMVW 189

  Fly   731 QESSHLLVMLTTVMESGRQKCHQYWPVTGE--------------ELQLAEGFSVRCLSEKPDETG 781
            ||:...:||||...:..:..||||||...|              |.||| .|.:|          
  Fly   190 QENISAIVMLTKTFDFAKVMCHQYWPPNMEVHEQYGDIFINIVREEQLA-NFHIR---------- 243

  Fly   782 SFVFREFVLKDKHE---QRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAARNRTLLQEIEESLK 843
              .||.:.:.:|.|   :|.|....|..|..|..|.. |..|||..|||......:         
  Fly   244 --TFRLYKMNEKQEVTDERLILQFHYTEWYSHSCPFS-NALLEFRRRVRLVVGNII--------- 296

  Fly   844 QVRLMDADADADENGGLMRERKCAASNGATPEDETPVSTSVHQCISAANPPVIVHCSAGIGRTGV 908
                    .|.|:..|                                  |::||||.|.||:||
  Fly   297 --------KDEDDMRG----------------------------------PILVHCSDGGGRSGV 319

  Fly   909 LILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECI 955
            .:.:|..|.|.|..|.......::.:|..|..:|:||.||:|:.:.:
  Fly   320 YMSIDANLELAEEEECFNVFGYLKKLRQSRKGLVENVEQYKFIYDTL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528 91/308 (30%)
PTPc 668..955 CDD:238006 90/306 (29%)
Ptp36ENP_001286033.1 Y_phosphatase 125..368 CDD:395053 91/310 (29%)
Y_phosphatase 428..671 CDD:395053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.