DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Ptp10D

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_996413.2 Gene:Ptp10D / 32115 FlyBaseID:FBgn0004370 Length:1990 Species:Drosophila melanogaster


Alignment Length:372 Identity:113/372 - (30%)
Similarity:158/372 - (42%) Gaps:97/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   591 QRSAPLLLEEEPLYQYVPESDEIGSHSNLLDGDALFTQSLLLLSDGLASGALLAQYELMYRKNPD 655
            :::.|:|::            ....|..|:..|:.|..|              .::|.:.....|
  Fly  1247 EQNRPILIK------------NFAEHYRLMSADSDFRFS--------------EEFEELKHVGRD 1285

  Fly   656 LAITEARKPANAPKNRYRDISPYDCTRVSL--VNSLTG-DYINANYVNMEIPG-GAVNRYIATQG 716
            ...|.|..|.|.||||:.:|.|||.:|..|  |:...| ||||||||    || .:...:|.|||
  Fly  1286 QPCTFADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYV----PGHNSPREFIVTQG 1346

  Fly   717 PLASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEG-FSVRCLSEKPDET 780
            ||.||..|||||..:.:|..:||||...|.||:||.||||  .:.:.:..| ..|:.|::  ...
  Fly  1347 PLHSTRDDFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP--NDTVPVFYGDIKVQILND--SHY 1407

  Fly   781 GSFVFREFVLKDKHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAARNRTLLQEIEESLKQV 845
            ..:|..||:|....|||.:.|..:..|||..||:.|...:.|   |||.|:|             
  Fly  1408 ADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRF---VRAFRDR------------- 1456

  Fly   846 RLMDADADADENGGLMRERKCAASNGATPEDETPVSTSVHQCISAANPPVIVHCSAGIGRTGVLI 910
                                                      |.|...|::||||||:||:|..|
  Fly  1457 ------------------------------------------IGAEQRPIVVHCSAGVGRSGTFI 1479

  Fly   911 LMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICA 957
            .:|..|..:...:.|....||..||.:|..|||...||..:.:|:.|
  Fly  1480 TLDRILQQINTSDYVDIFGIVYAMRKERVWMVQTEQQYICIHQCLLA 1526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528 99/293 (34%)
PTPc 668..955 CDD:238006 98/291 (34%)
Ptp10DNP_996413.2 fn3 124..205 CDD:278470
fn3 220..304 CDD:278470
fn3 315..391 CDD:278470
FN3 405..494 CDD:238020
FN3 511..574 CDD:238020
FN3 583..671 CDD:238020
fn3 683..753 CDD:278470
fn3 787..850 CDD:278470
fn3 866..935 CDD:278470
fn3 961..1043 CDD:278470
PTPc 1272..1525 CDD:214550 106/332 (32%)
PTPc 1298..1525 CDD:238006 99/292 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443515
Domainoid 1 1.000 133 1.000 Domainoid score I1104
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.