DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Frmd3

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:XP_038965420.1 Gene:Frmd3 / 298141 RGDID:1304802 Length:595 Species:Rattus norvegicus


Alignment Length:407 Identity:134/407 - (32%)
Similarity:205/407 - (50%) Gaps:39/407 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KKTPQRQQCVTVLFLDDITHTFRIEKRAKGSELLDQVFQYLELSERDYFGLLF--PQKPGDVVRW 89
            |...|..:| |:..|||...:.||::..||..|::.:..|..|.|:||||:.:  |:|..   .|
  Rat    26 KSLNQEMKC-TIRLLDDSEVSCRIQRETKGQFLIEYICNYYSLLEKDYFGIRYVDPEKQR---HW 86

  Fly    90 VDAQKQFKKQCSSVSLDNDAVPLLEFRVKFFVSDPSRLQEEFTRYQFYLQIKRNILLGKLPCSSN 154
            ::..|...||..|     .....:.|||||:..:|.:::||.|||..||||||:|..|:|.||..
  Rat    87 LEPNKSIFKQMKS-----HPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFT 146

  Fly   155 TQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVGELHKLH-RGQLPADAEYNYL 218
            ....|.:..||:|.||:...||...|:|..::...|:.:.|||:.|:|... |||.||.||:|.|
  Rat   147 DAAYLGACIVQAEFGDYYPDEHPENYISEFEIFPKQSQKLERKIMEIHNNELRGQSPAMAEFNLL 211

  Fly   219 EHAKRLELYGIDLHRATDSNGKELQLGVSAVGLLVFQHSLRVNTFSWSKMVKVSFKRKDFFIQLR 283
            ..|..||.||:|.|...||.|....||.:|.|.:|||.:.|::...||.:.|:.|:.|.|:: :.
  Rat   212 LKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWSDVCKLKFEGKTFYV-IG 275

  Fly   284 REPSENYDTLLGFGMSSHKHAKALWKSCVEHHSFFRLKRPHRLSRFLNISL---GSKFYYSGRTE 345
            .:..:|  .:|.|..|:....|.|||..||:.:|::..:..::....:..:   ||:|.|||:..
  Rat   276 SQKEKN--AVLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVA 338

  Fly   346 LQAVQESKQRGR----IHKVFV---RS-------------PSKRLLGAAGGVGTSGSSG-GTPMQ 389
            .:.|:.|.:..|    :|:|.:   ||             |.:.||.:..........| |||:.
  Rat   339 KEVVEASSKIQRDPPEVHRVNITQSRSFHSLNKQLIINMEPLQPLLPSPTEQEEEVPMGEGTPLP 403

  Fly   390 QHSGSESANSHNNGKPA 406
            :...|||..|.:..|.|
  Rat   404 KMDVSESLISSSPVKGA 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604 77/199 (39%)
FERM_N 38..102 CDD:286467 21/65 (32%)
FERM_M 125..232 CDD:278785 47/107 (44%)
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010 32/93 (34%)
FA 333..369 CDD:285894 14/58 (24%)
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528
PTPc 668..955 CDD:238006
Frmd3XP_038965420.1 B41 33..225 CDD:214604 77/200 (39%)
PH-like 206..309 CDD:418428 39/105 (37%)
FA 323..365 CDD:400882 11/41 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.