DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Mpp4

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_001158154.1 Gene:Mpp4 / 227157 MGIID:2386681 Length:654 Species:Mus musculus


Alignment Length:241 Identity:53/241 - (21%)
Similarity:91/241 - (37%) Gaps:86/241 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 PIL--LPTTIADA---------VGHQQP--------ESGSDLITIRLQADEQGRYGFNVKGGVDL 525
            |:|  ||..|.|:         |.:|||        |...|::..|:           :.||:  
Mouse   154 PLLPPLPDNIPDSEEAMRIVCLVKNQQPLGATIKRHEITGDILVARV-----------IHGGL-- 205

  Fly   526 SLPVQVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRP 590
               |:.|.:            :..||:::.:||..|.||..|||:.::.    .:.|.::..|.|
Mouse   206 ---VERSGL------------LYAGDKLVEVNGVSVEGLDPEQVIHILA----MSCGTIMFKVIP 251

  Fly   591 QRSAPLLLEEEPLY-----QYVPESDE----IGSHSNLLDGDALFTQSLLLLSDGLASGALLAQY 646
            . |||.:..::.:|     .|.|:.|.    :.:....|.||.|               .::.|.
Mouse   252 V-SAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDIL---------------QIVDQN 300

  Fly   647 ELMY---RKNPDLAITEARKPAN-APKNRYRDI------SPYDCTR 682
            :.::   ||..||.|.....|:| ..|.:.|:.      .|:.|.:
Mouse   301 DALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492 16/86 (19%)
Y_phosphatase 666..955 CDD:278528 5/24 (21%)
PTPc 668..955 CDD:238006 4/21 (19%)
Mpp4NP_001158154.1 L27 <66..100 CDD:197794
L27 108..154 CDD:280918 53/241 (22%)
PDZ_signaling 171..250 CDD:238492 22/110 (20%)
SH3_MPP4 264..324 CDD:212967 15/74 (20%)
Guanylate_kin 446..636 CDD:279019
GuKc 454..637 CDD:214504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.