DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Snta1

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:NP_033254.2 Gene:Snta1 / 20648 MGIID:101772 Length:499 Species:Mus musculus


Alignment Length:150 Identity:39/150 - (26%)
Similarity:71/150 - (47%) Gaps:19/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 PSPMP-PAYSSGQHSPILLPTTIADAVGHQQPESGSDLITIRLQADEQGRYGFNVKGGVDLSLPV 529
            |.|.| ||..:|...|...|..:.:|:..|:..     :|:| :|| .|..|.::|||.:..:|:
Mouse    49 PGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRR-----VTVR-KAD-AGGLGISIKGGRENKMPI 106

  Fly   530 QVSKVVPHTPADRCTPRVCEGDEVLMINGRDVHGLRHEQVVAMIRDCRHQASGELLLTVRPQRSA 594
            .:||:.....||: |..:..||.:|.:||.|:....|::.|..::    :...|::|.|:     
Mouse   107 LISKIFKGLAADQ-TEALFVGDAILSVNGEDLSSATHDEAVQALK----KTGKEVVLEVK----- 161

  Fly   595 PLLLEEEPLYQYVPESDEIG 614
             .:.|..|.::.......:|
Mouse   162 -YMKEVSPYFKNSAGGTSVG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492 25/86 (29%)
Y_phosphatase 666..955 CDD:278528
PTPc 668..955 CDD:238006
Snta1NP_033254.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..68 7/18 (39%)
PDZ_signaling 80..161 CDD:238492 25/92 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..203 0/3 (0%)
PHsplit_syntrophin <203..264 CDD:269960
PH 292..395 CDD:278594
PH 292..395 CDD:214574
Calmodulin-binding 477..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.