DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Ptprs

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:XP_006523937.1 Gene:Ptprs / 19280 MGIID:97815 Length:1920 Species:Mus musculus


Alignment Length:374 Identity:121/374 - (32%)
Similarity:155/374 - (41%) Gaps:100/374 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 PLLLEEEPLYQYVPESDEIGSHSNLLDGDALFTQSLLLLSDGLASGALLAQYELMYRKNPDLAIT 659
            |.:|...|    :|.:|.......|...|:|               .|..:||.:   :|....|
Mouse  1337 PGMLSHPP----IPITDMAEHMERLKANDSL---------------KLSQEYESI---DPGQQFT 1379

  Fly   660 --EARKPANAPKNRYRDISPYDCTRVSL--VNSLTG-DYINANYVNMEIPGG--AVNRYIATQGP 717
              .:...||.|||||.::..||.:||.|  :..:.| ||||||||:     |  ..|.|||||||
Mouse  1380 WEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVD-----GYRRQNAYIATQGP 1439

  Fly   718 LASTTTDFWRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGF-SVRCLSEKPDETG 781
            |..|..||||||.::.|..:||:|.:.|..|.||.||||..|.|   ..|| .|..|...  |..
Mouse  1440 LPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTE---TYGFIQVTLLDTM--ELA 1499

  Fly   782 SFVFREFVL--KDKHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAARNRTLLQEIEESLKQ 844
            :|..|.|.|  ....|:|.:.|.|:.|||||.||..|..||.|..||:.                
Mouse  1500 TFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKT---------------- 1548

  Fly   845 VRLMDADADADENGGLMRERKCAASNGATPEDETPVSTSVHQCISAANPPVIVHCSAGIGRTGVL 909
                                       ..|.|.               .|::||||||:||||..
Mouse  1549 ---------------------------CNPPDA---------------GPIVVHCSAGVGRTGCF 1571

  Fly   910 ILMDTALALMEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAA 958
            |::|..|..::..:.|.....|..||.||..|||...||.|:.|.:..|
Mouse  1572 IVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEA 1620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528 106/296 (36%)
PTPc 668..955 CDD:238006 105/294 (36%)
PtprsXP_006523937.1 I-set 33..124 CDD:400151
Ig strand A 33..36 CDD:409353
Ig strand A' 42..45 CDD:409353
Ig strand B 50..57 CDD:409353
Ig strand C 63..68 CDD:409353
Ig strand C' 71..73 CDD:409353
Ig strand D 80..84 CDD:409353
Ig strand E 86..93 CDD:409353
Ig strand F 103..111 CDD:409353
Ig strand G 114..124 CDD:409353
IgI_2_RPTP_IIa_LAR_like 137..226 CDD:409400
Ig strand B 152..156 CDD:409400
Ig strand C 165..169 CDD:409400
Ig strand E 190..194 CDD:409400
Ig strand F 204..209 CDD:409400
Ig strand G 216..219 CDD:409400
IgI_3_RPTP_IIa_LAR_like 239..320 CDD:409401
Ig strand B 253..257 CDD:409401
Ig strand C 266..270 CDD:409401
Ig strand E 287..291 CDD:409401
Ig strand F 299..304 CDD:409401
Ig strand G 312..315 CDD:409401
FN3 323..412 CDD:238020
FN3 419..511 CDD:238020
FN3 516..604 CDD:238020
FN3 612..706 CDD:238020
FN3 714..819 CDD:238020
FN3 929..1017 CDD:238020
FN3 1022..1105 CDD:238020
PTP_tm <1211..1295 CDD:408631
R-PTPc-S-1 1342..1623 CDD:350473 119/369 (32%)
R-PTP-S-2 1625..1914 CDD:350475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.