DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpmeg and Ptpn20

DIOPT Version :9

Sequence 1:NP_001163309.2 Gene:Ptpmeg / 38059 FlyBaseID:FBgn0261985 Length:974 Species:Drosophila melanogaster
Sequence 2:XP_006518791.1 Gene:Ptpn20 / 19256 MGIID:1196295 Length:463 Species:Mus musculus


Alignment Length:297 Identity:96/297 - (32%)
Similarity:132/297 - (44%) Gaps:77/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   666 NAPKNRYRDISPYDCTRVSLVNSLTGDYINANYVNMEIPGGAVNR-----YIATQGPLASTTTDF 725
            |..|||||||.|||.|||.|  ....|||||:|:.:      ||.     ||||||||..|..||
Mouse   226 NRDKNRYRDILPYDSTRVPL--GKNKDYINASYIRI------VNHEEEYFYIATQGPLPETIEDF 282

  Fly   726 WRMVQQESSHLLVMLTTVMESGRQKCHQYWPVTGEELQLAEGFSVRCLSEKPDETGSFVFREF-- 788
            |:||.:.:.:::.|:|..:|.|..||:.|||::.:|....|.|||  ..|....|..|..|.|  
Mouse   283 WQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSV--FLETFHVTQYFTVRVFQI 345

  Fly   789 VLKDKHEQRHIHHMQYLAWPDHCVPSDPNLFLEFTERVRAARNRTLLQEIEESLKQVRLMDADAD 853
            |.|...:.:.:.|:|:..||||..|:..:.|:::...||.                         
Mouse   346 VKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRK------------------------- 385

  Fly   854 ADENGGLMRERKCAASNGATPEDETPVSTSVHQCISAANPPVIVHCSAGIGRTGVLILMDTALAL 918
                                               |....|::||||||:|||||.|.:|...:.
Mouse   386 -----------------------------------SHITGPLLVHCSAGVGRTGVFICVDVVFSA 415

  Fly   919 MEAREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECI 955
            :|.......::||..||.||..|:|...||:|..|.:
Mouse   416 IEKNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PtpmegNP_001163309.2 B41 35..232 CDD:214604
FERM_N 38..102 CDD:286467
FERM_M 125..232 CDD:278785
FERM_C_PTPN4_PTPN3_like 226..320 CDD:270010
FA 333..369 CDD:285894
PDZ_signaling 502..589 CDD:238492
Y_phosphatase 666..955 CDD:278528 96/295 (33%)
PTPc 668..955 CDD:238006 95/293 (32%)
Ptpn20XP_006518791.1 PTP_DSP_cys 251..457 CDD:391942 80/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.