DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl10 and si:dkey-100n23.5

DIOPT Version :9

Sequence 1:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_001332705.1 Gene:si:dkey-100n23.5 / 793886 ZFINID:ZDB-GENE-070912-347 Length:349 Species:Danio rerio


Alignment Length:214 Identity:49/214 - (22%)
Similarity:89/214 - (41%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 FSI--PFMMLTIAVYLLIPELRNQHGKSLVCYLIGLSVG--YSSLCYVQLYQVDATGVTCKVFGY 315
            |||  .|.||.: ::||  ...|...:.:|   |.|:|.  :.|:.|| :.:....|..|....:
Zfish    39 FSILACFFMLCL-IWLL--RRNNSLAQKMV---INLTVAALFDSVAYV-MGESHPEGSLCNFQAW 96

  Fly   316 TAYFFFMGAYMWLSVISFDLWHNFRGTRGINRFQEKKRFLFYSLYSWGIALVFLAFTYCAQQLTN 380
            ...:|...|.:|:.:|:|:|:.|.     :...:.:...:.|.:.:||:.::.......|.... 
Zfish    97 WLTYFDWTALVWVCLITFNLYLNL-----VREIRTEHYRIRYHVVAWGVPVIMSTIPLMAGYYG- 155

  Fly   381 LPANLKPGIGDGVYCWL--DMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARII-- 441
             ||        |.:||:  |...|...|: |.|:.::::.....:              ||||  
Zfish   156 -PA--------GAWCWITDDHVGWRFGIW-YIPLFSLIIVMICCY--------------ARIICV 196

  Fly   442 ASENSTKNLRT---EKDKR 457
            |:|.....|.|   |:::|
Zfish   197 ANERMRSWLGTFNPERERR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145
7tm_4 244..514 CDD:304433 49/214 (23%)
si:dkey-100n23.5XP_001332705.1 7tm_4 40..193 CDD:304433 39/189 (21%)
Git3_C 212..277 CDD:288797 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.