DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl10 and mthl8

DIOPT Version :9

Sequence 1:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:534 Identity:130/534 - (24%)
Similarity:224/534 - (41%) Gaps:94/534 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YCGVTLLGVLCLVVFRLIPGIPFGTYV---MAERDHYHTIDDPNVPCNFYDTVNLTG-HRLFPNG 73
            :|   :||||.::         .||:.   ..|..||        ||.|.||.|:|| :.|  :|
  Fly     4 FC---ILGVLLIL---------SGTHCSWGFHEETHY--------PCAFIDTANITGSYGL--DG 46

  Fly    74 SYDYYGTIVPAELVGTYDY-IHSSLTERIEVREHVRGCVCKFKSCLNICCPWRQVFNSEVDGCII 137
            .:.:..|::|...|..||: |.:.:  ||....|:|.||||.|.|:.|||...::::.|...|::
  Fly    47 PFVHNWTVIPRHFVAVYDFVIENGI--RIPASRHLRACVCKTKPCVRICCLRGEIYDLEKRQCLV 109

  Fly   138 DHSDNRTWPDPPMLNITFRNESTILVNMFTQFAIQSFRPCPKMFSLQPETNNWDDYLLFENGSML 202
            ..:...:.|....:.:...|.|..||.:..:|:|....||..|.:: .:.:.:..:.|.|||:  
  Fly   110 PVAGVSSLPSHSHMEVELGNGSLRLVKLQPRFSIHVETPCEHMKAV-TKGSEYVHWTLHENGT-- 171

  Fly   203 RVDDKLLIRKNEFCMVPTYVNESDMFYTIHPANCDMQDDHSTVKIIN-SYA--MMFSIPFMMLTI 264
             :..:..|....:|..|.....|.  :...|..|..:..:..:.:.. :||  ::.:|..|.:.:
  Fly   172 -ISHRGHIFSKHYCFTPLLHGNST--WEWQPLACAPEKLYFVLGVREWTYAICLLIAILSMFIVL 233

  Fly   265 AVYLLIPELRNQ-HGKSLVCYLIGLSVGYSSLCYVQLYQ-VDATGVTCKVFGYTAYFFFMGAYMW 327
            .|||:..|:||. :|.::..|.|.:.:||:.|.|:.|:. .:.:...|::....|....:.::..
  Fly   234 MVYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLTLHNPANLSNAACRILPSLALMNLVLSFYI 298

  Fly   328 LSVISFDLWHNFRGTRGINRFQEKKRFLFYSLYSW----GIALV------FLAFTYCAQQLTNLP 382
            ||.|:|.|:.:|.|.            :|..|..|    .|.||      |:.|:|...:|    
  Fly   299 LSFIAFKLYLSFYGV------------VFTKLMFWLIFTPIVLVAVGWSFFVGFSYYGSRL---- 347

  Fly   383 ANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENST 447
                  |..|..||.|..||:.|||||.|:......:...::::.|.|              ...
  Fly   348 ------IFGGDTCWFDPRNWSVMIYFYAPVFVACAISGFFYVLSQIYI--------------RDQ 392

  Fly   448 KNLRTEKDKRFYRAWSNYRFGLFLRLFLIMGITWLTELISYFVGSDKGW---SKLFYISDLANAM 509
            .::.|||.   :.:....||..|.:.|....:.|:..:.|:  ..:..|   |.|.|......|.
  Fly   393 PDIETEKS---FESIEKNRFKSFWKYFGYTAVVWVVCICSF--AFNYYWENRSHLNYAVSFCMAF 452

  Fly   510 QGFLIFMLFVMKKK 523
            .||......:.|.:
  Fly   453 HGFAALYALIGKNQ 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145 49/181 (27%)
7tm_4 244..514 CDD:304433 68/287 (24%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 49/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.