DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl10 and LOC110439897

DIOPT Version :9

Sequence 1:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021333226.1 Gene:LOC110439897 / 110439897 -ID:- Length:111 Species:Danio rerio


Alignment Length:110 Identity:25/110 - (22%)
Similarity:44/110 - (40%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 RGINRFQEKKRFLFYSLYSWGIALVFLAFTYCAQQLTNLPANLKP-GIGDGVYCWLDMSN---WA 403
            :.:::...||:.:..|.:...|..|......|      :...|.| |.| ..:||:....   |:
Zfish    13 KNLSQISSKKKEVLSSGFLCVIGYVLAMVVVC------VSIGLVPEGYG-SEHCWIKYDKGFIWS 70

  Fly   404 AMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENSTK 448
                |.||:..|:..|.|:||...|.::....::...|:....||
Zfish    71 ----FLGPVCVILALNLILFIRIVIYLNSALSKLNAEISQLKQTK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145
7tm_4 244..514 CDD:304433 25/110 (23%)
LOC110439897XP_021333226.1 7tm_GPCRs <1..>111 CDD:333717 23/108 (21%)
TM helix 4 30..46 CDD:320095 3/21 (14%)
TM helix 5 64..87 CDD:320095 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.