DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atac3 and GABPB1

DIOPT Version :9

Sequence 1:NP_001246531.1 Gene:Atac3 / 38055 FlyBaseID:FBgn0052343 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_024305651.1 Gene:GABPB1 / 2553 HGNCID:4074 Length:400 Species:Homo sapiens


Alignment Length:532 Identity:135/532 - (25%)
Similarity:204/532 - (38%) Gaps:166/532 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VDLGKQLLQCARDSDVAGVKAALAHGAPFASDWLGMSALHFAAMNNQLEICEILLQGGINMDGKT 116
            |||||:||:.||......|:..:|:||||.:||||.|.||.||........|:||:.|::.|.:|
Human     9 VDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDART 73

  Fly   117 KVDRTPLHLACYYGHERIVSLLLALKCSVNSRDMLRMTPLHWAVEKKHKGIVRLLLKCQADVTLV 181
            ||||||||:|...||..||.:||.....||::|||:||.||||.|..|:.:|.||:|..|||...
Human    74 KVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQ 138

  Fly   182 SKFGKTPIGLAVYTEQADVLAELEAARQAQASKKLHEESEQQAHKTKKETNEAVSSIMDEPEVIK 246
            |||.||...:::.....|:...|:.|.|.|.:             |..|:.:.|:.....|:.| 
Human   139 SKFCKTAFDISIDNGNEDLAEILQIAMQNQIN-------------TNPESPDTVTIHAATPQFI- 189

  Fly   247 TVDDKEMSVEERMDVLENMRGHANVLRNTALYILKTHEIADMVQDNDDEDSKEMLNTALQNGRQL 311
                               .|...|:..|.                                  |
Human   190 -------------------IGPGGVVNLTG----------------------------------L 201

  Fly   312 VLSEGGRMLLHETKSGISGKQSTNGNARPSVAALRTNVNNSHPKIRMNVLKQKDLPSPAGVAKNK 376
            |.||.......||  |:|..|.  ||:..||.|            .:..|.:...|    ::.:.
Human   202 VSSENSSKATDET--GVSAVQF--GNSSTSVLA------------TLAALAEASAP----LSNSS 246

  Fly   377 NIRIISLTDFKKLYGSDSTAKSLQKIPASLASSG---MVRHLPDGTKLVNMRQLQARQLKLPSLQ 438
            ...:::..:.       .||:|:......:.|||   ::..:.||.:|.|:              
Human   247 ETPVVATEEV-------VTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNL-------------- 290

  Fly   439 RPQDLTALEESHSQNEAAVPSP----LPSGHPASGSSLRGQVGTVQTIQLRPSLSAGSGQGAVNN 499
                       ||...:.:..|    :|.|.         ||.||                    
Human   291 -----------HSIPTSGIGQPIIVTMPDGQ---------QVLTV-------------------- 315

  Fly   500 GAAPGKTIVNATKQSPKSPNVMPLLTSSEICRQLHELRRQNEDLRRRADSFQREKEEMLRRIDRL 564
               |...|...|..|.:.|       :...|.::.|.|.::.::..| ::.|::.:|..|...:.
Human   316 ---PATDIAEETVISEEPP-------AKRQCIEIIENRVESAEIEER-EALQKQLDEANREAQKY 369

  Fly   565 EQMVLVQESEAD 576
            .|.:|.:|.||:
Human   370 RQQLLKKEQEAE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atac3NP_001246531.1 Ank_4 58..106 CDD:290365 20/47 (43%)
ANK repeat 58..83 CDD:293786 10/24 (42%)
ANK 81..204 CDD:238125 56/122 (46%)
ANK repeat 88..116 CDD:293786 10/27 (37%)
Ank_2 90..181 CDD:289560 45/90 (50%)
ANK repeat 118..149 CDD:293786 16/30 (53%)
ANK repeat 151..181 CDD:293786 16/29 (55%)
ANK repeat 184..211 CDD:293786 7/26 (27%)
GABPB1XP_024305651.1 ANK repeat 15..40 CDD:293786 10/24 (42%)
ANK 39..161 CDD:238125 56/121 (46%)
ANK repeat 43..73 CDD:293786 11/29 (38%)
ANK repeat 75..106 CDD:293786 16/30 (53%)
ANK repeat 108..138 CDD:293786 16/29 (55%)
ERM <328..>394 CDD:330563 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4175
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1514706at2759
OrthoFinder 1 1.000 - - FOG0002988
OrthoInspector 1 1.000 - - otm42119
orthoMCL 1 0.900 - - OOG6_107779
Panther 1 1.100 - - O PTHR24193
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5776
SonicParanoid 1 1.000 - - X1982
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.