DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and PREX2

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_079146.2 Gene:PREX2 / 80243 HGNCID:22950 Length:1606 Species:Homo sapiens


Alignment Length:378 Identity:96/378 - (25%)
Similarity:174/378 - (46%) Gaps:75/378 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  3027 IRRSAVRELLDTEVNYVKLLAAICDGYLPAMSK----RID-IFSPNSIRLIFSNITAIYKFQRKF 3086
            :|...:.||..||.:||..|..:...:|..|::    ::| ..:..:::::||||..|....::|
Human    23 LRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVHKEF 87

  Fly  3087 LEALRRGIE-----QNQVAKVFLKMHKGFLCYSTYCNAYPRA---LIELETYDRVKDARTILENC 3143
            |:.:...:.     |.:|...||.....|..|..||:.:.:|   |:||   ::::..||.|.||
Human    88 LKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLLLEL---NKIRTIRTFLLNC 149

  Fly  3144 R--ESQNLAELPLSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQLD 3206
            .  ..:...::||..:|:.|:||||:|||.|.|::|                ::..|.:||.   
Human   150 MLLGGRKNTDVPLEGYLVTPIQRICKYPLILKELLK----------------RTPRKHSDYA--- 195

  Fly  3207 VTELDIPDSQDTVNLALEAMRGITEAVNEGKRHS---ETIARHQASFQNFKGPPL-----HLHSA 3263
                       .|..||:||:.:...:||.||..   |.:...|:..:.::|..:     .:...
Human   196 -----------AVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMC 249

  Fly  3264 RFFLQVDATRQKQNLWNSSYTLFLFDNQLVYCKRD--IIKRS-------HFIYKGRIFLDRCRVV 3319
            ...|::.:...::.::      |||||.||||||.  .:|.|       .::::|||..:...|.
Human   250 GVLLKISSGNIQERVF------FLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRINTEVMEVE 308

  Fly  3320 NVRDG----KMFGHTIKNSLRIYSESRDKWYDFSFRSANRKHRFLSTLALERQ 3368
            ||.||    ...||.:.|..:|::.:::||:....::...||.:...:..||:
Human   309 NVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKERE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 56/218 (26%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 35/150 (23%)
PH <3285..3363 CDD:278594 29/90 (32%)
PREX2NP_079146.2 RhoGEF 27..213 CDD:279015 56/218 (26%)
PH_Collybistin_ASEF 218..364 CDD:269931 35/150 (23%)
PH 248..356 CDD:278594 30/113 (27%)
DEP_1_P-Rex 382..462 CDD:239886
DEP_2_P-Rex 474..566 CDD:239887
PDZ_signaling 595..670 CDD:238492
PDZ_signaling 677..744 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1581..1606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40937
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.