DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and VAV2

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:XP_016870597.1 Gene:VAV2 / 7410 HGNCID:12658 Length:896 Species:Homo sapiens


Alignment Length:563 Identity:117/563 - (20%)
Similarity:197/563 - (34%) Gaps:171/563 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  3028 RRSAVRELLDTEVNYVKLLAAICDGYLPAMSKRIDIFSPNSIRLIFSNITAIYKFQRKFLEALRR 3092
            |...:.|:.:||..|.:.|..|...|:..:  |: :.||..:..:|.|:..:.|....||.|:..
Human   199 RNCCLLEIQETEAKYYRTLEDIEKNYMSPL--RL-VLSPADMAAVFINLEDLIKVHHSFLRAIDV 260

  Fly  3093 G--IEQNQVAKVFLKMHKGFLCYSTYCNAYPRALIELETYDRV----KDARTILENCRESQNLAE 3151
            .  :..:.:|||||...:..|.|..||:....|   ..|.:::    :|.|..:|.|.......:
Human   261 SVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHA---QNTLNQLLASREDFRQKVEECTLKVQDGK 322

  Fly  3152 LPLSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQLDVTELDIPDSQ 3216
            ..|...|:.|:||:.:|.|.|.|::..:.|:                              |:.|
Human   323 FKLQDLLVVPMQRVLKYHLLLKELLSHSAER------------------------------PERQ 357

  Fly  3217 DTVNLALEAMRGITEAVNEGKRHSET---IARHQASFQNFK------GPPLHLHSARFFLQVDAT 3272
            . :..|||||:.:...:||.||..||   |:..|:|.:|.:      |.|          ::|..
Human   358 Q-LKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRP----------KIDGE 411

  Fly  3273 RQKQNLWNSSYT---LFLFDNQLVYCKR--------------------------DIIKRSHF--- 3305
            .:.:::.|.:..   |||||..::.|||                          |:.|::.|   
Human   412 LKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKQAGFPLP 476

  Fly  3306 ----IYKGRIFLDRCRVVNVRDGKMFGHTI-------KNSLRIYSESRD---KWYD-FSFR---- 3351
                :..|.::         ..|||:.:..       |...:.:.::.|   ||.: |...    
Human   477 SHPAVLGGGLW---------SHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNI 532

  Fly  3352 ---SANRKHRFLSTLALERQFGGKAL-----------YVSEMTGFEYNYE----ERPGDYSDQSD 3398
               .||..|........::....||.           |:....|...:.|    ..|..::..:|
Human   533 KPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPAD 597

  Fly  3399 YDAQDFELATGVTSGESSL--------PESPAK-----STSRLCETLPKKSQSRDGISSAENSQI 3450
            .|      |:|...|...:        |..|.|     .|..:.|.|     ..|..|.....::
Human   598 LD------ASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELL-----RGDPESPWWEGRL 651

  Fly  3451 VTTTSTGSLGRRHFGNWFRKPKSANCTPSQSPTHKPSFDADAT 3493
            |.|..:|     :|.:...||...:..|..|  ..||.:.|.|
Human   652 VQTRKSG-----YFPSSSVKPCPVDGRPPIS--RPPSREIDYT 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 48/209 (23%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 33/195 (17%)
PH <3285..3363 CDD:278594 23/128 (18%)
VAV2XP_016870597.1 CH_VAV2 2..120 CDD:409112
RhoGEF 202..375 CDD:214619 48/209 (23%)
PH_Vav 389..534 CDD:269930 27/163 (17%)
C1_VAV2 537..594 CDD:410418 9/56 (16%)
SH3_VAV2_1 608..667 CDD:212913 12/68 (18%)
SH2_Vav2 685..787 CDD:198269 2/3 (67%)
SH3_VAV2_2 837..894 CDD:212910
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.