DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and Pex13

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_076140.2 Gene:Pex13 / 72129 MGIID:1919379 Length:405 Species:Mus musculus


Alignment Length:500 Identity:94/500 - (18%)
Similarity:161/500 - (32%) Gaps:166/500 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  2564 KPNKSRRTGRSRSLPSVMLRRLYLAGMPKPGSNEMGT--TSDCAASLSQQIKAVSSPTLSE--PC 2624
            ||.:|||      :|.        || |.|||....|  ::|...:|   :.....|||:.  |.
Mouse    10 KPWESRR------IPG--------AG-PGPGSGPGPTYQSADLGPTL---LTRPGQPTLTRVPPP 56

  Fly  2625 LEEQPQKGTESTDV-----ANTGSSAGSGGLGVLQKFKRTLNNFNNK-------------NQLHI 2671
            :..:|.:.|.|.:|     |.:..|:|.|..|         |:|...             |:|.:
Mouse    57 ILPRPSQQTGSNNVNTFRPAYSSFSSGYGAYG---------NSFYGSYSPYSYGYNGLGFNRLRV 112

  Fly  2672 SPLSPAAVGNNAPKTK-------TSPTTTTASIAPMITTTTASDPGS------EAGDTSSGKYRF 2723
            ..|.|:.....|.::.       .|.....||::.|:..|.::...|      .|...|..|..|
Mouse   113 DDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHF 177

  Fly  2724 GPLIWRSSKERRKTKYNRRDKCNSGDSGIQIELEQDEQY--SRATMA-VSRQDEPRAFALTNGSC 2785
            ..:....:..|......||.:..   .|::...|.::.:  |..|:| :|.:|:           
Mouse   178 TKVFSAFALVRTIRYLYRRLQWM---MGLRRGSENEDLWAESEGTVACLSAEDQ----------- 228

  Fly  2786 GVALSKMRAIRRTNSAKASSIL--------GPFIVKTKIAKHLNIGESDKAERKAPESLPTRSLS 2842
                       .|||||:..|.        ||:::...::.|.:                     
Mouse   229 -----------ATNSAKSWPIFLFFAVILGGPYLIWKLLSTHND--------------------- 261

  Fly  2843 QPNGLESYGMGRPDLEDSDSDSVASNEEAISFYPTTYAEVLYNFTAGGPQELGLERGMLIEILRK 2907
                           |.:|:.:.||.|:     ....|...|:|.|...:|:....|.::.:..|
Mouse   262 ---------------EVTDNTNWASGED-----DHVVARAEYDFVAVSDEEISFRAGDMLNLALK 306

  Fly  2908 EVGP----WWFGRIKKEETNLVEDILGPELGWFPKEFVRIIHCPETDNFFIAHRAAADEAAAEEA 2968
            |..|    |           |:..:.|...|..|..:|:|:            .........|.:
Mouse   307 EQQPKVRGW-----------LLASLDGQTTGLIPANYVKIL------------GKRRGRKTIESS 348

  Fly  2969 TARAEEGSVPVPVAAFAEDTDVTVTTDQSNVTLIVIESPPTPSAP 3013
            |...::.|...|.......|...:...::....:.:|:....|||
Mouse   349 TMLKQQQSFTNPTLIKGVTTTNPLDEQEAAFESVFVETNKVSSAP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620 14/69 (20%)
RhoGEF 3031..3235 CDD:279015
PH_Collybistin_ASEF 3240..3373 CDD:269931
PH <3285..3363 CDD:278594
Pex13NP_076140.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 22/78 (28%)
Peroxin-13_N 113..256 CDD:282008 31/167 (19%)
SH3_PEX13_eumet 278..335 CDD:212798 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.