DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and PLEKHG1

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_001316727.1 Gene:PLEKHG1 / 57480 HGNCID:20884 Length:1444 Species:Homo sapiens


Alignment Length:717 Identity:171/717 - (23%)
Similarity:262/717 - (36%) Gaps:208/717 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  2769 VSRQDEPRAFALTNGSCGVALSKMRAIRRTNSAKASSILGPFIVKTKIAKHLNIGESDKAERKAP 2833
            |.|:.:..| |.||...|.:::....:|....:..:.:..|   ||            .|.|..|
Human     6 VGRKRQETA-AWTNRVLGQSITDGHQLRLEVPSAVTKVPHP---KT------------TARRSCP 54

  Fly  2834 ESLPTRSLSQPNGLESYGMGRPDLEDSDSDSVASNEEAISFYPTTYAEVLYNFTAGGPQELGLER 2898
            :.|.|..||..:...|:|        |.|.|.:|.:...||              |....|....
Human    55 QELKTMELSDSDRPVSFG--------STSSSASSRDSHGSF--------------GSRMTLVSNS 97

  Fly  2899 GMLIEILRKEVGPWWFGRIKKEETNLVEDILGPELGWFPKEFVRIIHCPETDNFFIAHRAAADEA 2963
            .|.:....|||     |.||.|        |.|...:...|..|       ||          .|
Human    98 HMGLFNQDKEV-----GAIKLE--------LIPARPFSSSELQR-------DN----------PA 132

  Fly  2964 AAEEATARAEEGSVPVPVAAFAEDTDVTVTTDQSNVTLIVIESPPTPSAPSVDFVAQPDHSTIIR 3028
            ..::   .|:|||...|.|.:..|::....|        :.:|..:|....||.|          
Human   133 TGQQ---NADEGSERPPRAQWRVDSNGAPKT--------IADSATSPKLLYVDRV---------- 176

  Fly  3029 RSAVRELLDTEVNYVKLLAAICDGYLPAMSKRIDI-FSPNSIRLIFSNITAIYKFQRKFLEALRR 3092
               |:|:|:||..||:.|.:|.:.||..:..:..: ........:|.||..||.|..:.|:.| .
Human   177 ---VQEILETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDL-E 237

  Fly  3093 GIEQNQV--AKVFLKMHKGFLCYSTYCNAYPRALIELETYDRVKDARTILENCRESQNLAE---- 3151
            ..|.:.|  |:.|:...:.|..|:.||..|||::             .:|..|..::.||:    
Human   238 NCENDPVAIAECFVSKSEEFHIYTQYCTNYPRSV-------------AVLTECMRNKILAKFFRE 289

  Fly  3152 --------LPLSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQLDVT 3208
                    |||.::||.|||||.:|.|.|:| |::.|:|      ||:|                
Human   290 RQETLKHSLPLGSYLLKPVQRILKYHLLLHE-IENHLDK------DTEG---------------- 331

  Fly  3209 ELDIPDSQDTVNLALEAMRGITEAVNEGKR---HSETIARHQASFQNFKGPPLHLHSARFFLQVD 3270
                   .|.|..|::.|:.:...:|:.||   |:..:...|:...|:|||.|..:..   |.::
Human   332 -------YDVVLDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLTSYGE---LVLE 386

  Fly  3271 ATRQKQNLWNSSYTLFLFDNQLVYCKRDIIKRSHFIYKGRIFLDRCRVVNV-------------R 3322
            .|.:.|...|.. ||||||..|:..|:   :...|.||..|......:|.|             :
Human   387 GTFRIQRAKNER-TLFLFDKLLLITKK---RDDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYK 447

  Fly  3323 DGKMFGHTIKNSLRIYSESRDK--WYDFSFR----------SANRKHRFLSTLALER-------Q 3368
            :.|: .||::     ....:||  |.....|          .|..|...|...|:..       :
Human   448 NPKL-QHTVQ-----AKSQQDKRLWVLHLKRLILENHAAKIPAKAKQAILEMDAIHHPGFCYSPE 506

  Fly  3369 FGGKALYVSEMTGFEYNYEERPGDYSDQSDYDAQDFELATGV--TSGESSLPE------SPAKST 3425
            .|.|||:.|:.....|.. .|..:.|.:|....:..|.|..:  .|.|...|:      |||:..
Human   507 GGTKALFGSKEGSAPYRL-RRKSEPSSRSHKVLKTSETAQDIQKVSREEGSPQLSSARPSPAQRN 570

  Fly  3426 SR 3427
            |:
Human   571 SQ 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620 13/65 (20%)
RhoGEF 3031..3235 CDD:279015 58/218 (27%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 36/164 (22%)
PH <3285..3363 CDD:278594 23/102 (23%)
PLEKHG1NP_001316727.1 RhoGEF 176..351 CDD:279015 59/231 (26%)
PH_PLEKHG1_G2_G3 332..477 CDD:270063 39/157 (25%)
PH 381..474 CDD:278594 25/105 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.