DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and ARHGEF38

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_001229658.1 Gene:ARHGEF38 / 54848 HGNCID:25968 Length:777 Species:Homo sapiens


Alignment Length:434 Identity:94/434 - (21%)
Similarity:172/434 - (39%) Gaps:110/434 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  3028 RRSAVRELLDTEVNYVK-LLAAICDGYLPAMSKRIDIFSPNSIRLIFSNITAIYKFQRKFLEALR 3091
            |...::||:.||.:|:. |...:.:...|..:|:.|....:|   :||||.::::...|.|..|.
Human    95 REKIIKELIQTEKDYLNDLELCVREVVQPLRNKKTDRLDVDS---LFSNIESVHQISAKLLSLLE 156

  Fly  3092 RGIEQNQ-----VAKVFLKMHKGFL--CYSTYCNAYPRALIELETYDRVKDARTILENCRES--- 3146
            ......:     :.:|||:: ||.|  .|..||..:..|...||:|::.::.:..|.:|.:|   
Human   157 EATTDVEPAMQVIGEVFLQI-KGPLEDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLKK 220

  Fly  3147 -------QNLAELPLSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQ 3204
                   .||  |.:.:.::.|:||:.:|||.|.|:..|                :.....||..
Human   221 IYMQEGKPNL--LDMGSLMIKPIQRVMKYPLLLCELRNS----------------TPPSHPDYRA 267

  Fly  3205 LDVTELDIPDSQDTVNLALEAMRGITEAVNEGKRHSETIARHQASFQN----FKGPPLHLHSAR- 3264
            ||.              |..|::.|...:||.||..:.:.:::.:.::    .|...|::||.. 
Human   268 LDD--------------AFAAVKDINVNINELKRRKDLVLKYKKNDEDESLKDKLSKLNIHSISK 318

  Fly  3265 ---------FFLQVDATRQKQNLWNSSYTLF-LFDNQLVYCKRDIIKRSHFIYKG-----RIFLD 3314
                     ..|....::.|.|.:|....|| ..:..:..|.::|......|...     :..:|
Human   319 KSKRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCVKNISLCLQHIQDAMPLALQSVMD 383

  Fly  3315 RCRVVNVRDGKM-FGHTIKNSLRIYSESRDKWYDFSFRSANRKHRFLST--LALERQFGG----- 3371
            ...:...:|.:| :..|:.|:|       :..:||    |:...|.:.|  .||...|.|     
Human   384 LQEISYNKDDEMDYSETLSNAL-------NSCHDF----ASHLQRLILTPLSALLSLFPGPHKLI 437

  Fly  3372 -----KAL----YVSEMTGFEYNYEERPGDYSDQSDYDAQDFEL 3406
                 |.|    |:...||.|.:..::        :|:|.:.:|
Human   438 QKRYDKLLDCNSYLQRSTGEESDLAKK--------EYEALNAQL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 52/221 (24%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 28/165 (17%)
PH <3285..3363 CDD:278594 16/86 (19%)
ARHGEF38NP_001229658.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..72
RhoGEF 98..284 CDD:279015 52/221 (24%)
BAR_DNMBP 336..522 CDD:153273 32/157 (20%)
SH3 586..642 CDD:302595
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 673..694
SH3_DNMBP_C2 717..773 CDD:213017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.