DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and ARHGEF37

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:XP_011535944.1 Gene:ARHGEF37 / 389337 HGNCID:34430 Length:686 Species:Homo sapiens


Alignment Length:460 Identity:96/460 - (20%)
Similarity:163/460 - (35%) Gaps:146/460 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  3005 ESPPTPS-APSVDFVAQPDHSTIIRRSAVRELLDTEVNYVKLLAAICDGYLPAMSKRIDIFSPNS 3068
            :.|.:.| :|..:..|..|.|.:.:|.|||||:||||:|:.:| .:|   ...:..|:.......
Human    18 DEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHML-QLC---ASDIRSRLQQLPQGD 78

  Fly  3069 IRLIFSNITAIYKFQRKFLEALRRGIEQNQ-----VAKVFLKMHKGF-LCYSTYCNAYPRALIEL 3127
            :.::||||..|.|...:||..|:....:.:     |..:||:..:.. ..|..||.:|.:||:.:
Human    79 LDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKVYCASYDQALLLV 143

  Fly  3128 ETYDRVKDARTILENCRESQNLAE--LP------LSAHLLAPVQRICRYPLHLNEIIKSALEKGA 3184
            :||.:..:.:      |..|.:.|  :|      ||..|:.|:|||.||||.|.:|:::.     
Human   144 DTYRKEPELQ------RHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQKILENT----- 197

  Fly  3185 KEGNDTDGAKSAGKTTDYEQLDVTELDIPDSQ--DTVNLALEAMRGITEAVNEGKRHSETIARHQ 3247
                                       :||:.  ..:..|:.|::.:...:||.|...|..    
Human   198 ---------------------------VPDASAYPVLQRAVSALQDVNTNINEYKMRKEVA---- 231

  Fly  3248 ASFQNFKGPPLHLHSARFFLQVDATRQKQNLWNSSYTLFLFDNQLVYCKRDIIKRSHFIYKGRIF 3312
                                             |.||..   .||...:|.....:|.:.|....
Human   232 ---------------------------------SKYTKV---EQLTLRERLARINTHTLSKKTTR 260

  Fly  3313 LDRCRVVNVRDGKMFGHTIKNSLRIYSESRDKWYDFSFRSANRKHRFLSTLALERQFGGKALYVS 3377
            |.:              .:|....:...:.||.:|    ....:.:::|....|.: ...|.|:.
Human   261 LSQ--------------LLKQEAGLIPRTEDKEFD----DLEERFQWVSLCVTELK-NNVAAYLD 306

  Fly  3378 EMTGFEYNYEERPGDYSDQSDYDAQDFELATGVTSGESSLPESPAKSTSRLC-----ETLPKKSQ 3437
            .:..|.|   .||.:|:                    ..:||.||.....|.     |...|..|
Human   307 NLQAFLY---FRPHEYN--------------------LDIPEGPAVQYCNLARDLHLEAFLKFKQ 348

  Fly  3438 SRDGI 3442
            ..:|:
Human   349 RLEGL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 54/219 (25%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 16/132 (12%)
PH <3285..3363 CDD:278594 11/77 (14%)
ARHGEF37XP_011535944.1 RhoGEF 45..223 CDD:279015 54/219 (25%)
BAR_DNMBP 275..463 CDD:153273 21/107 (20%)
SH3_ARHGEF37_C1 521..574 CDD:212733
SH3_ARHGEF37_C2 617..673 CDD:212874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.