DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and Arhgef37

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_808496.2 Gene:Arhgef37 / 328967 MGIID:3045339 Length:676 Species:Mus musculus


Alignment Length:238 Identity:66/238 - (27%)
Similarity:114/238 - (47%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  3005 ESPPTPSAPSVDFVAQPDHSTIIRRSAVRELLDTEVNYVKLLAAICDGYLPAMSKRIDIFSPNSI 3069
            |:.....:|..:.....|.|.:.:|.|:|||:||||:|:.:| .:|...:.:..:::   .|..:
Mouse     8 EASSKSESPEQEDQGSEDRSLLHQRLAIRELIDTEVSYLHML-RLCASDIRSHLQQL---PPGDL 68

  Fly  3070 RLIFSNITAIYKFQRKFLEALR----RGIEQ-NQVAKVFLKMHKGF-LCYSTYCNAYPRALIELE 3128
            .::||||..|.:...:||..|:    |..|| :.:..:||:..:.| ..|..||..|.:||:.::
Mouse    69 DILFSNIDDIIQVSSRFLRGLQETACREEEQAHLIGNLFLEFQEEFEQVYKVYCANYDQALLLVK 133

  Fly  3129 TYDR----VKDARTILENCRESQNLAELP------LSAHLLAPVQRICRYPLHLNEIIKS----- 3178
            .|.:    .|:.:.|:|        |.:|      ||..|:.|:|||.:|||.|.:|:::     
Mouse   134 AYQKEPELQKEIQGIIE--------AAMPQAGPSGLSFFLVIPLQRITKYPLLLQKILENTPADA 190

  Fly  3179 ----ALEKGAKEGNDTDG--------AKSAGKTTDYEQLDVTE 3209
                ||::......|.:|        .:.|.|.|..|||.:.|
Mouse   191 SAHPALQRATSALQDVNGNINEYKMRKEVALKYTKVEQLSLRE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 61/212 (29%)
PH_Collybistin_ASEF 3240..3373 CDD:269931
PH <3285..3363 CDD:278594
Arhgef37NP_808496.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 2/17 (12%)
RhoGEF 34..211 CDD:366202 54/188 (29%)
BAR_DNMBP 264..452 CDD:153273
SH3_ARHGEF37_C1 510..563 CDD:212733
SH3_ARHGEF37_C2 607..663 CDD:212874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.