DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and Prex2

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_001380724.1 Gene:Prex2 / 312912 RGDID:1307865 Length:1598 Species:Rattus norvegicus


Alignment Length:383 Identity:98/383 - (25%)
Similarity:175/383 - (45%) Gaps:75/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  3022 DHSTIIRRSAVRELLDTEVNYVKLLAAICDGYLPAMSK----RID-IFSPNSIRLIFSNITAIYK 3081
            |....:|...:.||..||.:||..|..:...:|..|::    ::| ..:..:::::||||..|..
  Rat    10 DKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAAAKLDKNVTEETVKMLFSNIEEILA 74

  Fly  3082 FQRKFLEALRRGIE-----QNQVAKVFLKMHKGFLCYSTYCNAYPRA---LIELETYDRVKDART 3138
            ..::||:.:...:.     |.:|...||.....|..|..||:.:.:|   |:||   ::::..||
  Rat    75 VHKEFLKVVEECLHPEPNAQQEVGTCFLNFKDKFRIYDEYCSNHEKAQKLLLEL---NKIRTIRT 136

  Fly  3139 ILENCR--ESQNLAELPLSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTD 3201
            .|.||.  ..:...::||..:|:.|:||||:|||.|.|::|                ::..|.:|
  Rat   137 FLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLK----------------RTPRKHSD 185

  Fly  3202 YEQLDVTELDIPDSQDTVNLALEAMRGITEAVNEGKRHS---ETIARHQASFQNFKGPPL----- 3258
            |              ..|..||:||:.:...:||.||..   |.:...||..:.::|..:     
  Rat   186 Y--------------TAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQAHIEGWEGSNITDTCT 236

  Fly  3259 HLHSARFFLQVDATRQKQNLWNSSYTLFLFDNQLVYCKRD--IIKRS-------HFIYKGRIFLD 3314
            .:......:::.:...::.::      |||||.||||||.  .:|.|       .::::|||..:
  Rat   237 EMLMCGVLMKISSGNIQERVF------FLFDNLLVYCKRKHRRLKNSKASTDGHRYVFRGRINTE 295

  Fly  3315 RCRVVNVRDG----KMFGHTIKNSLRIYSESRDKWYDFSFRSANRKHRFLSTLALERQ 3368
            ...|.||.||    ...||.:.|..:|::.:::||:....:|...||.:...:..||:
  Rat   296 VMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKSPEEKHEWFEAILKERE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 56/218 (26%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 36/150 (24%)
PH <3285..3363 CDD:278594 30/90 (33%)
Prex2NP_001380724.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45073
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.