DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and Prex1

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:NP_001129190.1 Gene:Prex1 / 311647 RGDID:1306534 Length:1646 Species:Rattus norvegicus


Alignment Length:376 Identity:106/376 - (28%)
Similarity:173/376 - (46%) Gaps:66/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  3027 IRRSAVRELLDTEVNYVKLLAAICDGYLPAMSKRI-----DIFSPNSIRLIFSNITAIYKFQRKF 3086
            :|...:.|:|.||.:||..|..:...:|..:.:.:     ...:..:::::||||..|.:..:.|
  Rat    44 LRLCVLNEILATERDYVGTLRFLQSAFLQRIRQNVADSVDKGLTEENVKILFSNIEDILEVHKDF 108

  Fly  3087 LEALRRGI-----EQNQVAKVFLKMHKGFLCYSTYCNAYPRALIELETYDRVKDARTILENCR-- 3144
            |.||...:     .|:::..||||....|..|..||:.:.:||..|...::|..||..|.||.  
  Rat   109 LAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKVPAARAFLLNCMLL 173

  Fly  3145 ESQNLAELPLSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQLDVTE 3209
            ..:...::||..:||:|:||||:|||.|.|:.|                ::.||..|:       
  Rat   174 GGRKTTDIPLEGYLLSPIQRICKYPLLLKELSK----------------RTPGKHPDH------- 215

  Fly  3210 LDIPDSQDTVNLALEAMRGITEAVNEGKRHS---ETIARHQASFQNFKGPPLHLHSARFFLQVDA 3271
                   ..|..||:||:.:...:||.||..   |.:.:.|:..:.::|..|.....:..||  .
  Rat   216 -------SAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQ--G 271

  Fly  3272 TRQKQNLWN-SSYTLFLFDNQLVYCKR--------------DIIKRSHFIYKGRIFLDRCRVVNV 3321
            |..|.:..| .....|||||.||||||              ..|..|.:|::|||..:...|.||
  Rat   272 TLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENV 336

  Fly  3322 RDG----KMFGHTIKNSLRIYSESRDKWYDFSFRSANRKHRFLSTLALERQ 3368
            .||    ...|:|:.|..:|::.:::||:....::|..|.::|..|..||:
  Rat   337 EDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDALIRERE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 58/215 (27%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 43/151 (28%)
PH <3285..3363 CDD:278594 31/95 (33%)
Prex1NP_001129190.1 RhoGEF 48..234 CDD:279015 58/215 (27%)
PH_Collybistin_ASEF 239..391 CDD:269931 43/151 (28%)
PH 278..384 CDD:278594 33/105 (31%)
DEP 409..489 CDD:295306
DEP_2_P-Rex 501..593 CDD:239887
PDZ 630..697 CDD:214570
PDZ 714..768 CDD:238080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.