DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and Vav2

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:XP_006497917.1 Gene:Vav2 / 22325 MGIID:102718 Length:878 Species:Mus musculus


Alignment Length:553 Identity:118/553 - (21%)
Similarity:190/553 - (34%) Gaps:169/553 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  3028 RRSAVRELLDTEVNYVKLLAAICDGYLPAMSKRIDIFSPNSIRLIFSNITAIYKFQRKFLEALRR 3092
            |...:.|:.:||..|.:.|..|...|:..:  |: :.||..:..:|.|:..:.|....||.|:..
Mouse   199 RSCCLLEIQETEAKYYRTLEDIEKNYMGPL--RL-VLSPADMAAVFINLEDLIKVHHSFLRAIDV 260

  Fly  3093 GIEQ--NQVAKVFLKMHKGFLCYSTYCNAYPRALIEL-ETYDRVKDARTILENCRESQNLAELPL 3154
            .:..  :.:|||||:..:..|.|..||:....|...| :.....:|.|..:|.|.......:..|
Mouse   261 SMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSTLNQLLASREDFRQKVEECTLRVQDGKFKL 325

  Fly  3155 SAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQLDVTELDIPDSQDTV 3219
            ...|:.|:||:.:|.|.|.|::..:.::                              |:.|. :
Mouse   326 QDLLVVPMQRVLKYHLLLKELLSHSADR------------------------------PERQQ-L 359

  Fly  3220 NLALEAMRGITEAVNEGKRHSET---IARHQASFQNFK------GPPLHLHSARFFLQVDATRQK 3275
            ..|||||:.:...:||.||..||   |:..|.|.:|.:      |.|          ::|...:.
Mouse   360 KEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRP----------KIDGELKV 414

  Fly  3276 QNLWNSSYT---LFLFDNQLVYCKR-------------------------DIIKRSHFIYKGRIF 3312
            :::.|.:..   |||||..::.|||                         ..||:||        
Mouse   415 RSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKSH-------- 471

  Fly  3313 LDRCRVVNVRDGKMFGHTI-------KNSLRIYSESRD---KWYD-FSFR-------SANRKHRF 3359
                       |||:.:..       |...:.:.::.|   ||.: |...       .||..|..
Mouse   472 -----------GKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHS 525

  Fly  3360 LSTLALERQFGGKAL-----------YVSEMTGFEYNYE----ERPGDYSDQSDYDAQDFELATG 3409
            ......::....||.           |:....|...:.|    ..|...|..:|.|      |.|
Mouse   526 FQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSSPADVD------APG 584

  Fly  3410 VTSGESSL--------PESPAK-----STSRLCETLPKKSQSRDGISSAENSQIVTTTSTGSLGR 3461
            ...|...:        |..|.|     .|..:.|.|     ..|..|.....::|.|..:|    
Mouse   585 AGPGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELL-----RGDPDSPWWEGRLVQTRKSG---- 640

  Fly  3462 RHFGNWFRKPKSANCTPSQSPTHK-PSFDADAT 3493
             :|.:...||...:..|   ||.: ||.:.|.|
Mouse   641 -YFPSSSVKPCPVDGRP---PTGRPPSREIDYT 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 47/206 (23%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 33/187 (18%)
PH <3285..3363 CDD:278594 23/120 (19%)
Vav2XP_006497917.1 CAMSAP_CH 18..103 CDD:314792
RhoGEF 202..375 CDD:214619 47/206 (23%)
PH_Vav 389..516 CDD:269930 27/155 (17%)
C1 524..571 CDD:237996 5/46 (11%)
SH3_VAV2_1 590..649 CDD:212913 12/68 (18%)
SH2_Vav2 667..769 CDD:198269 2/3 (67%)
SH3_VAV2_2 819..876 CDD:212910
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1291
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.