DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF3 and arhgef38

DIOPT Version :9

Sequence 1:NP_612024.4 Gene:RhoGEF3 / 38050 FlyBaseID:FBgn0264707 Length:3519 Species:Drosophila melanogaster
Sequence 2:XP_009289887.1 Gene:arhgef38 / 100317614 ZFINID:ZDB-GENE-090313-83 Length:762 Species:Danio rerio


Alignment Length:310 Identity:69/310 - (22%)
Similarity:120/310 - (38%) Gaps:72/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  2989 DVTVTT----DQSNVTLIVIESPPTPSAPSVDFVAQP-------DHSTIIRRS-AVRELLDTEVN 3041
            |:::.|    .||:.|....:.....|...:..:|.|       .|..:|:|| .:.||:.||.:
Zfish    53 DISIATLVRRSQSDKTEYSSKLKEKMSPHGLSLLASPAMDPEEIRHRKMIKRSKVIEELVRTEGD 117

  Fly  3042 YVK-LLAAICDGYLPAMSKRIDIFSPNSIRLIFSNITAIYKFQRKFLEALRRGI-----EQNQVA 3100
            |.: |...|.:..||....::     ..:..:|:||.::.......|..|:..|     |...:.
Zfish   118 YQRDLELCINEVLLPLREAQV-----VDVDRLFTNIESVCDVSNDLLLRLQDAIADPDPETQLIG 177

  Fly  3101 KVFLKMHKGFL--CYSTYCNAYPRALIELETYDRVKDARTILENC----------RESQNLAELP 3153
            :||::. |..:  .|..||..:..|...|::|:..:|.:.....|          ....||  |.
Zfish   178 EVFIQT-KAVIEEVYKIYCYHHDEANASLKSYEAQEDIQQQFRRCISALKKIYDLEGKPNL--LD 239

  Fly  3154 LSAHLLAPVQRICRYPLHLNEIIKSALEKGAKEGNDTDGAKSAGKTTDYEQLDVTELDIPDSQDT 3218
            :.:.|:.|||||.:|||.|.|:                             .:.|..|.||.: .
Zfish   240 MGSLLIKPVQRIMKYPLLLAEL-----------------------------WNATPTDHPDHR-P 274

  Fly  3219 VNLALEAMRGITEAVNEGKRHSETIARHQASFQNF----KGPPLHLHSAR 3264
            :..||..::.|...:||.||..:.:.:::.|....    |....::||.|
Zfish   275 LQEALTTVKIINININEFKRRKDIVLKYKRSDDETSLMGKLNKFNIHSIR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF3NP_612024.4 DUF4802 <754..>790 CDD:292678
SH3 2876..2942 CDD:214620
RhoGEF 3031..3235 CDD:279015 48/221 (22%)
PH_Collybistin_ASEF 3240..3373 CDD:269931 5/29 (17%)
PH <3285..3363 CDD:278594
arhgef38XP_009289887.1 RhoGEF 107..291 CDD:279015 48/221 (22%)
BAR_DNMBP 343..524 CDD:153273
SH3 591..646 CDD:302595
SH3_DNMBP_C2 703..758 CDD:213017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3519
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.